DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5955 and HSD3B1

DIOPT Version :9

Sequence 1:NP_649230.1 Gene:CG5955 / 40268 FlyBaseID:FBgn0036997 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_000853.1 Gene:HSD3B1 / 3283 HGNCID:5217 Length:373 Species:Homo sapiens


Alignment Length:335 Identity:68/335 - (20%)
Similarity:130/335 - (38%) Gaps:72/335 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 LITGGLGQLGIECAKLLRTQYGSQNVILSD-----IIKPSQSVLENG---PYIFADILDFKGLQK 105
            |:||..|.||....:||..:...:.:.:.|     .::...|.|:|.   ..:..||||...|::
Human     7 LVTGAGGFLGQRIIRLLVKEKELKEIRVLDKAFGPELREEFSKLQNKTKLTVLEGDILDEPFLKR 71

  Fly   106 IVVDHRIDWLIHFSALLSAVGEQNVPLAVRVNIEGVHNVIELAKQYKLRIFV-PSTIGAFGPDSP 169
            ...|  :..:||.:.::...|..:....:.||::|...::|...|..:.:|: .|:|...||:|.
Human    72 ACQD--VSVIIHTACIIDVFGVTHRESIMNVNVKGTQLLLEACVQASVPVFIYTSSIEVAGPNSY 134

  Fly   170 RNPTPNVTIQRP-RTIYGVSKVHAELIGE--------YYYHKFGLDFRCLRFPGVISSDPPGGGT 225
            :....|...:.| ...:.....|::.:.|        :.....|..:.|...|..|.     |..
Human   135 KEIIQNGHEEEPLENTWPAPYPHSKKLAEKAVLAANGWNLKNGGTLYTCALRPMYIY-----GEG 194

  Fly   226 TDYAVAVFHEALRN-------GKYTCYLRPDTRLPMMYIED-------CLRALLEFMRAPNEQLK 276
            :.:..|..:|||.|       ||::. :.|      :|:.:       .||||.:..:||:  ::
Human   195 SRFLSASINEALNNNGILSSVGKFST-VNP------VYVGNVAWAHILALRALQDPKKAPS--IR 250

  Fly   277 RRVYNVTAMSFTPEELFAQLGKHVPNLHVTYKPDSRQLIADAWPQVFDDSDARRDWHWQHKYDLS 341
            .:.|.::  ..||.:.:       .||:.|               :..:...|.|..|.....|.
Human   251 GQFYYIS--DDTPHQSY-------DNLNYT---------------LSKEFGLRLDSRWSFPLSLM 291

  Fly   342 NLVDFMIKDV 351
            ..:.|:::.|
Human   292 YWIGFLLEIV 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5955NP_649230.1 WcaG 47..355 CDD:223528 68/335 (20%)
TDH_SDR_e 47..351 CDD:187580 67/333 (20%)
HSD3B1NP_000853.1 3b-HSD_HSDB1_like_SDR_e 5..357 CDD:187671 68/335 (20%)
3Beta_HSD 7..287 CDD:279420 65/319 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0451
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.