DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5955 and Hsd3b2

DIOPT Version :9

Sequence 1:NP_649230.1 Gene:CG5955 / 40268 FlyBaseID:FBgn0036997 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_058961.4 Gene:Hsd3b2 / 29632 RGDID:67377 Length:373 Species:Rattus norvegicus


Alignment Length:226 Identity:58/226 - (25%)
Similarity:86/226 - (38%) Gaps:59/226 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 LITGGLGQLGIECAKLLRTQYGSQNV-ILSDIIKPSQ-------------SVLENGPYIFADILD 99
            |:||..|.||....:||..:...:.| :|..:.:|..             :|||      .||||
  Rat     7 LVTGAGGFLGQRIVQLLVQEKDLKEVRVLDKVFRPETREEFFNLGTSIKVTVLE------GDILD 65

  Fly   100 FKGLQKIVVDHRIDWLIHFSALLSAVGEQNVPLAVRVNIEGVHNVIELAKQYKLRIFV-PSTIGA 163
            .:.|::..  ..|..:||.:||:...|.......:.||::|..|::|...|..:..|: .||:..
  Rat    66 TQCLRRAC--QGISVVIHTAALIDVTGVNPRQTILDVNLKGTQNLLEACVQASVPAFIYCSTVDV 128

  Fly   164 FGPDSPRNPTPNVTIQRPRTIYGVSKVHAELI--GEYYYHKFGLDFRCLRFPGVISSDPPGGGTT 226
            .||:|.:....|          |..:.|.|..  ..|.|.|...:...|...|.|..:   |||.
  Rat   129 AGPNSYKKIILN----------GHEEEHHESTWSNPYPYSKKMAEKAVLAANGSILKN---GGTL 180

  Fly   227 DYAVAVFHEALRNGKYTCYLRPDTRLPMMYI 257
                           :||.|||      |||
  Rat   181 ---------------HTCALRP------MYI 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5955NP_649230.1 WcaG 47..355 CDD:223528 58/226 (26%)
TDH_SDR_e 47..351 CDD:187580 58/226 (26%)
Hsd3b2NP_058961.4 NADB_Rossmann 5..357 CDD:304358 58/226 (26%)
3Beta_HSD 7..287 CDD:279420 58/226 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.