DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5955 and Uxs1

DIOPT Version :9

Sequence 1:NP_649230.1 Gene:CG5955 / 40268 FlyBaseID:FBgn0036997 Length:367 Species:Drosophila melanogaster
Sequence 2:XP_038938945.1 Gene:Uxs1 / 246232 RGDID:628680 Length:459 Species:Rattus norvegicus


Alignment Length:273 Identity:61/273 - (22%)
Similarity:114/273 - (41%) Gaps:40/273 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 KILITGGLGQLGIECAKLLRTQYGSQNVILSDIIKPSQSVLEN--GPYIFADILDFKGLQKIVVD 109
            :||||||.|.:|......|... |.:..::.:.....:..:|:  |...| ::::...::.:.::
  Rat   129 RILITGGAGFVGSHLTDKLMMD-GHEVTVVDNFFTGRKRNVEHWIGHENF-ELINHDVVEPLYIE 191

  Fly   110 HRIDWLIHFSALLSAVGEQNVPL-AVRVNIEGVHNVIELAKQYKLRIFVPSTIGAFGPDSPRNPT 173
              :|.:.|.::..|.......|: .::.|..|..|::.|||:...|:.:.||...:| |...:|.
  Rat   192 --VDQIYHLASPASPPNYMYNPIKTLKTNTIGTLNMLGLAKRVGARLLLASTSEVYG-DPEVHPQ 253

  Fly   174 P-----NVTIQRPRTIYGVSKVHAELIGEYYYHKFGLDFRCLRF-----PGVISSDPPGGGTTDY 228
            .     :|....||..|...|..||.:...|..:.|::.|..|.     |.:..:|  |...:::
  Rat   254 SEDYWGHVNPIGPRACYDEGKRVAETMCYAYMKQEGVEVRVARIFNTFGPRMHMND--GRVVSNF 316

  Fly   229 AVAVFHEALRNGKYTCYLRPDTRLPMMYIEDCLRALLEFMRAPNEQLKRRVYNVTA--MSFTPEE 291
            .:    :||:....|.|..........|:.|.:..|:..|.:          ||::  ....|||
  Rat   317 IL----QALQGEPLTVYGSGSQTRAFQYVSDLVNGLVALMNS----------NVSSPVNLGNPEE 367

  Fly   292 ----LFAQLGKHV 300
                .||||.|::
  Rat   368 HTILEFAQLIKNL 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5955NP_649230.1 WcaG 47..355 CDD:223528 61/273 (22%)
TDH_SDR_e 47..351 CDD:187580 61/273 (22%)
Uxs1XP_038938945.1 UXS1_N <64..117 CDD:403108
UGD_SDR_e 128..431 CDD:187541 61/273 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0451
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.