DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5955 and Hsd3b7

DIOPT Version :9

Sequence 1:NP_649230.1 Gene:CG5955 / 40268 FlyBaseID:FBgn0036997 Length:367 Species:Drosophila melanogaster
Sequence 2:XP_006230274.1 Gene:Hsd3b7 / 246211 RGDID:628727 Length:369 Species:Rattus norvegicus


Alignment Length:374 Identity:82/374 - (21%)
Similarity:127/374 - (33%) Gaps:114/374 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 LITGGLGQLGIECAK-LLRTQYGSQNVILSDI-IKPSQSVLENGPY----IFADILDFKGLQKIV 107
            |:|||.|.||....: ||..:...:.:.:.|: :......|:.||.    |..|:.....:...:
  Rat    13 LVTGGCGFLGEHIVRMLLEWEPRLRELRVFDLHLSSWLEELKTGPVQVTAIQGDVTQAHEVAAAM 77

  Fly   108 VDHRIDWLIHFSALLSAVGEQNVPLAVRVNIEGVHNVIELAKQYKLRIFV-PSTIGAFGP----- 166
            ....:  :||.:.|:...|:.:.....:||::|..|||:...|...|:.| .|::...||     
  Rat    78 AGSHV--VIHTAGLVDVFGKASPETIHKVNVQGTQNVIDACVQTGTRLLVYTSSMEVVGPNVKGH 140

  Fly   167 -------DSP-----RNP-----------------------TPNVTIQ-RPRTIYGVSKVHAELI 195
                   |:|     |:|                       .|.||.. ||..|||    ....:
  Rat   141 PFYRGNEDTPYEAIHRHPYPCSKALAEQLVLEANGRKVNGGLPLVTCALRPTGIYG----EGHQV 201

  Fly   196 GEYYYHKFGLDFRCLRFPGVISSDPPG----GGTTDYAVAVFHE-----ALRNGK-YTCYLRPDT 250
            ...:||: ||.|....|..:.:|...|    |......:.|..|     ||..|: |.||.:...
  Rat   202 MRDFYHQ-GLRFGGRLFRAIPASVEHGRVYVGNVAWMHILVARELEQRAALMGGQVYFCYDKSPY 265

  Fly   251 R----LPMMYIEDC---------------------LRALLEFMRAP----NEQLKRRVYNVTAMS 286
            :    ..|.::..|                     |.|||:::..|    ...|......|...:
  Rat   266 KSYEDFNMEFLSPCGLRLIGTHPLLPYWLLVLLAALNALLQWLLRPLVLYTPLLNPYTLAVANTT 330

  Fly   287 FTPEELFAQLGKHVPNLHVTYKPDSRQLIADAWPQVFDDSDAR-RDWHW 334
            ||.....||       .|..|||            :|...::| |..||
  Rat   331 FTVSTNKAQ-------RHFGYKP------------LFSWEESRARTIHW 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5955NP_649230.1 WcaG 47..355 CDD:223528 82/374 (22%)
TDH_SDR_e 47..351 CDD:187580 82/374 (22%)
Hsd3b7XP_006230274.1 NADB_Rossmann 11..361 CDD:304358 82/374 (22%)
3Beta_HSD 13..283 CDD:279420 62/276 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0451
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.