DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5955 and uxs1

DIOPT Version :9

Sequence 1:NP_649230.1 Gene:CG5955 / 40268 FlyBaseID:FBgn0036997 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_775349.2 Gene:uxs1 / 192315 ZFINID:ZDB-GENE-020419-37 Length:418 Species:Danio rerio


Alignment Length:300 Identity:68/300 - (22%)
Similarity:123/300 - (41%) Gaps:43/300 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 KILITGGLGQLGIECAKLLRTQYGSQNVILSDIIKPSQSVLEN--GPYIFADILDFKGLQKIVVD 109
            :||||||.|.:|......|... |.:..::.:.....:..:|:  |...| ::::...::.:.::
Zfish    88 RILITGGAGFVGSHLTDKLMMD-GHEVTVVDNFFTGRKRNVEHWIGHENF-ELINHDVVEPLYIE 150

  Fly   110 HRIDWLIHFSALLSAVGEQNVPL-AVRVNIEGVHNVIELAKQYKLRIFVPSTIGAFG-PD-SPRN 171
              :|.:.|.::..|.......|: .::.|..|..|::.|||:...|:.:.||...:| |: .|:|
Zfish   151 --VDQIYHLASPASPPNYMYNPIKTLKTNTIGTLNMLGLAKRVGARLLLASTSEVYGDPEVHPQN 213

  Fly   172 PT--PNVTIQRPRTIYGVSKVHAELIGEYYYHKFGLDFRCLRFPGVISSD---PPGGGTTDYAVA 231
            ..  .:|....||..|...|..||.:...|..:.|::.|..|......|.   ..|...:::.: 
Zfish   214 EDYWGHVNPIGPRACYDEGKRVAETMCYAYMKQEGVEVRVARIFNTFGSRMHMNDGRVVSNFIL- 277

  Fly   232 VFHEALRNGKYTCYLRPDTRLPMMYIEDCLRALLEFMRAPNEQLKRRVYNVTAMSFTPEE----L 292
               :||:....|.|..........|:.|.:..|:..|   |..:...| |:.    .|||    .
Zfish   278 ---QALQGEALTVYGSGSQTRAFQYVSDLVNGLVSLM---NSNISSPV-NLG----NPEEHTILE 331

  Fly   293 FAQLGKHV--PNLHVTYKPDSRQLIADAWPQVFDDSDARR 330
            ||||.|.:  ...|:.:.|:::           ||...||
Zfish   332 FAQLIKSLVASRSHIQFLPEAQ-----------DDPQRRR 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5955NP_649230.1 WcaG 47..355 CDD:223528 67/299 (22%)
TDH_SDR_e 47..351 CDD:187580 67/299 (22%)
uxs1NP_775349.2 UXS1_N 2..76 CDD:288636
WcaG 87..394 CDD:223528 67/299 (22%)
UGD_SDR_e 87..389 CDD:187541 67/299 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 397..418
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0451
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.