DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5955 and hsd-2

DIOPT Version :9

Sequence 1:NP_649230.1 Gene:CG5955 / 40268 FlyBaseID:FBgn0036997 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_508851.1 Gene:hsd-2 / 191049 WormBaseID:WBGene00022498 Length:374 Species:Caenorhabditis elegans


Alignment Length:298 Identity:77/298 - (25%)
Similarity:111/298 - (37%) Gaps:67/298 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 LITGGLGQLGIECAKLLRTQYGSQNVILSD-------IIKPSQSVLENGPYIFADILDFKGLQKI 106
            :|.||.|.||......|:.....:.:|:.|       .||..:|   |..||.|..||.|.|:.|
 Worm     5 VIVGGGGFLGAHVISALQKIGCKERIIVVDPCPQEFKTIKIDKS---NISYIKASFLDDKVLENI 66

  Fly   107 VVDHRIDWLIHFSALLSAVGEQNVPLAVR-----VNIEGVHNVIELAKQYKLRIFV------PST 160
            :  :....::|    |:|||...:....|     .|:.|...:|:..|...::.|:      .|.
 Worm    67 L--NGASAVVH----LAAVGHTGLIAGDRKSVHNFNVNGTKQLIKQCKALGVKRFLYASSVAVSF 125

  Fly   161 IGAFGPDSPRNPTPNVTIQRP-------RTIYGVSKVHAELIGEYYYHKFGLDFR--CLRFPGVI 216
            ||        .|..|||...|       ...|..||..||   .|...:...||:  ||||.|:.
 Worm   126 IG--------EPLDNVTEDDPLPDPKKYLDFYSASKAEAE---TYVLSQSTPDFKTVCLRFRGIY 179

  Fly   217 SSDPPGGGTTDYAVAVFHEALRNGKYTCYLRPDTRLPMMYIE---DCLR--ALLEFMRAPNEQLK 276
            ..:.|   .....||   ..::||.:...:....|..:....   :|.:  ||.:.|....:.|.
 Worm   180 GPEDP---NVTLKVA---NLIKNGLFIGMVSAHGRESVSCASSGVNCAKAFALADQMLQNPDGLH 238

  Fly   277 RRVY------NVTAMSF-TPEELFAQLGKHVPNLHVTY 307
            .|.|      ||....| ||  |...|||..|:.:..|
 Worm   239 GRAYYILDGENVGQFQFWTP--LVLALGKQPPSFYTPY 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5955NP_649230.1 WcaG 47..355 CDD:223528 77/298 (26%)
TDH_SDR_e 47..351 CDD:187580 77/298 (26%)
hsd-2NP_508851.1 NADB_Rossmann 5..327 CDD:389744 77/298 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0451
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.