DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5955 and Hsd3b2

DIOPT Version :9

Sequence 1:NP_649230.1 Gene:CG5955 / 40268 FlyBaseID:FBgn0036997 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_001346670.1 Gene:Hsd3b2 / 15493 MGIID:96234 Length:373 Species:Mus musculus


Alignment Length:360 Identity:74/360 - (20%)
Similarity:121/360 - (33%) Gaps:122/360 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 LITGGLGQLGIECAKLLRTQYGSQNV-ILSDIIKPSQ-------------SVLENGPYIFADILD 99
            |:||..|.||....:||..:...:.: :|..:.:|..             :|||      .||||
Mouse     7 LVTGAGGFLGQRIIQLLVQEEDLEEIRVLDKVFRPETRKEFFNLETSIKVTVLE------GDILD 65

  Fly   100 FKGLQKIVVDHRIDWLIHFSALLSAVGEQNVPLAVRVNIEGVHNVIELAKQYKLRIFV-PSTIGA 163
            .:.|::..  ..|..:||.:|::...|.......:.||::|..|::|...|..:..|: .|::..
Mouse    66 TQYLRRAC--QGISVVIHTAAIIDVTGVIPRQTILDVNLKGTQNLLEACIQASVPAFIFSSSVDV 128

  Fly   164 FGPDSPRNPTPNVTIQRPRTIYGVSKVHAELIGE------YYYHKFGLDFRCLRFPGVISSDPPG 222
            .||:|.:....|              .|.|...|      |.|.|...:...|...|.:..:   
Mouse   129 AGPNSYKEIVLN--------------GHEEECHESTWSDPYPYSKKMAEKAVLAANGSMLKN--- 176

  Fly   223 GGTTDYAVAVFHEALRNGKYTCYLRPDTRLPMMYIEDCLRALLEFMRAPNEQLKRRVYNVTAMSF 287
            |||..               ||.|||    ..:|.|          |:|      .:.|:..|:.
Mouse   177 GGTLQ---------------TCALRP----MCIYGE----------RSP------LISNIIIMAL 206

  Fly   288 TPEELFAQLGK---------------HV------------PNLHVTYKPDSRQLIADAWP-QVFD 324
            ..:.:....||               |:            ||:...:     ..|:|..| |.||
Mouse   207 KHKGILRSFGKFNTANPVYVGNVAWAHILAARGLRDPKKSPNIQGEF-----YYISDDTPHQSFD 266

  Fly   325 DSD--ARRDW------HWQHKYDLSNLVDFMIKDV 351
            |..  ..::|      .|.....|...:.|:::.|
Mouse   267 DISYTLSKEWGFCLDSSWSLPVPLLYWLAFLLETV 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5955NP_649230.1 WcaG 47..355 CDD:223528 74/360 (21%)
TDH_SDR_e 47..351 CDD:187580 73/358 (20%)
Hsd3b2NP_001346670.1 SDR 5..357 CDD:330230 74/360 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0451
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.