powered by:
Protein Alignment CG5955 and ZC449.8
DIOPT Version :9
Sequence 1: | NP_649230.1 |
Gene: | CG5955 / 40268 |
FlyBaseID: | FBgn0036997 |
Length: | 367 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001257016.1 |
Gene: | ZC449.8 / 13220478 |
WormBaseID: | WBGene00195189 |
Length: | 70 |
Species: | Caenorhabditis elegans |
Alignment Length: | 42 |
Identity: | 13/42 - (30%) |
Similarity: | 19/42 - (45%) |
Gaps: | 10/42 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 139 EGV-HNVIELAKQYKLRIFVP-----STI--GAFGPDSPRNP 172
||| .||:.:.|..:.:...| ||: |:..| |..|
Worm 27 EGVLTNVVSILKTQENQDVAPSFTDQSTVVKGSIPP--PNTP 66
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG5955 | NP_649230.1 |
WcaG |
47..355 |
CDD:223528 |
13/42 (31%) |
TDH_SDR_e |
47..351 |
CDD:187580 |
13/42 (31%) |
ZC449.8 | NP_001257016.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0451 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.