DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5955 and Hsd3b7

DIOPT Version :9

Sequence 1:NP_649230.1 Gene:CG5955 / 40268 FlyBaseID:FBgn0036997 Length:367 Species:Drosophila melanogaster
Sequence 2:XP_036008429.1 Gene:Hsd3b7 / 101502 MGIID:2141879 Length:372 Species:Mus musculus


Alignment Length:298 Identity:62/298 - (20%)
Similarity:96/298 - (32%) Gaps:99/298 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 LIHFSALLSAVGEQNVPLAVRVNIEGVHNVIELAKQYKLRIFV-PSTIGAFGPDSPRNP------ 172
            :||.:.|:...|:.:.....:||::|..|||:...|...:..| .|::...||:...:|      
Mouse    86 VIHTAGLVDVFGKASPKTIHKVNVQGTQNVIDACVQTGTQYLVYTSSMEVVGPNIKGHPFYRGNE 150

  Fly   173 -TPNVTIQ----------------------------------RPRTIYGVSKVHAELIGEYYYHK 202
             ||...:.                                  ||..|||...   :::.::||. 
Mouse   151 DTPYEAVHSHPYPCSKALAEQLVLEANGRKVNGGLPLVTCALRPTGIYGEGH---QVMRDFYYQ- 211

  Fly   203 FGLDFRCLRFPGVISSDPPG----GGTTDYAVAVFHE-----ALRNGK-YTCYLRPDTR----LP 253
             ||.|....|..|.:|...|    |......:.|..|     ||..|: |.||.:...:    ..
Mouse   212 -GLRFGGRLFRAVPASVEHGRVYVGNVAWMHILVARELEQRAALMGGQVYFCYDKSPYKSYEDFN 275

  Fly   254 MMYIEDC---------------------LRALLEFMRAP----NEQLKRRVYNVTAMSFTPEELF 293
            |.::..|                     |.|||:::..|    ...|......:...:||.....
Mouse   276 MEFLSPCGLRLIGAHPLLPYWLLVLLATLNALLQWLLRPLVLYTPLLNPYTLAMANTTFTVSTNK 340

  Fly   294 AQLGKHVPNLHVTYKP-----DSRQLIADAWPQVFDDS 326
            ||       .|..|||     :||..... |.|..:.|
Mouse   341 AQ-------RHFGYKPLFSWEESRTRTIQ-WVQAMEGS 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5955NP_649230.1 WcaG 47..355 CDD:223528 62/298 (21%)
TDH_SDR_e 47..351 CDD:187580 62/298 (21%)
Hsd3b7XP_036008429.1 3b-HSD_HSDB1_like_SDR_e 20..364 CDD:187671 59/290 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0451
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.