DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5955 and hsd3b7

DIOPT Version :9

Sequence 1:NP_649230.1 Gene:CG5955 / 40268 FlyBaseID:FBgn0036997 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_001120501.1 Gene:hsd3b7 / 100145626 XenbaseID:XB-GENE-1008841 Length:380 Species:Xenopus tropicalis


Alignment Length:229 Identity:45/229 - (19%)
Similarity:80/229 - (34%) Gaps:79/229 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 LITGGLGQLGIECAK-LLRTQYGSQNVILSDI-IKPSQSVLENG----PYIFADILDFKGLQKIV 107
            ::|||.|.||....: ||..:.....:.:.|: :..|...|.|.    ..|..||.....:::.:
 Frog    10 VVTGGCGFLGSHLVRMLLEHEKNISEIRVFDLHLDESLRSLSNNRVRVRLISGDISHLDDVREAL 74

  Fly   108 VDHRIDWLIHFSALLSAVGEQNVPLAVRVNIEGVHNVIELAKQYKLRIFV-PSTIGAFGPDSPRN 171
              |....:||.::|:...|.........||:.|..||::..|:..::..| .|::...||:    
 Frog    75 --HGSHLVIHTASLVDVWGRVPASKINEVNVTGTENVLQACKEEGVQYLVYTSSMEVVGPN---- 133

  Fly   172 PTPNVTIQRPRTIYGVSKVHAELIGEYYYHKFGLDFRCLRFPGVISSDPPGGGTTDYAVAVFHE- 235
                              :|    |:::|.                    |...|:|  .::|: 
 Frog   134 ------------------IH----GDHFYR--------------------GNEETEY--RIYHKE 154

  Fly   236 -------------------ALRNGK--YTCYLRP 248
                               .::.||  |||.|||
 Frog   155 PYPLSKAKAEKLVLEANGTKMKGGKMLYTCSLRP 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5955NP_649230.1 WcaG 47..355 CDD:223528 45/229 (20%)
TDH_SDR_e 47..351 CDD:187580 45/229 (20%)
hsd3b7NP_001120501.1 NADB_Rossmann 8..358 CDD:389744 45/229 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.