DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mag and EAT1

DIOPT Version :9

Sequence 1:NP_649229.1 Gene:mag / 40267 FlyBaseID:FBgn0036996 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_011529.1 Gene:EAT1 / 852898 SGDID:S000003247 Length:328 Species:Saccharomyces cerevisiae


Alignment Length:331 Identity:68/331 - (20%)
Similarity:121/331 - (36%) Gaps:93/331 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 EKRPPILLQHGLFSNSDCWLSSGPDNSLAYLLA---DAGYDVWLGNARGNIYSRNNIIISLNSHK 133
            |:||.|:..|||..:...:      :||..||:   ||  |::      ::..||:.|    |.|
Yeast    36 EQRPAIINIHGLLGSHVMF------HSLNKLLSRKLDA--DIF------SVDVRNHGI----SPK 82

  Fly   134 FWHFDWHEIGTIDIPAMIDYILADTGFDQ-IHYAGHSQG------TTVY-------LVMLS---- 180
            ...:|:..: |.|   :|.:|....|.:: |:..|.|.|      ||:|       .:.:.    
Yeast    83 AIPYDYTTL-TND---LIYFIETHIGLERPIYLLGFSMGGKIALLTTLYKNINIRKCISIDLPPY 143

  Fly   181 ERPEYNALIKSGHLLAPCAFFEHGTSFIFNALGPLVGTPGGIWNQLLVDTELIPNNNLVNRLVDN 245
            |.||.:.:|...:.|.        ...|...:..|.|:|.  |.:.:::             :..
Yeast   144 ETPELDPMILQNYDLI--------MRIIRRDVKILRGSPS--WQKKVLE-------------LFK 185

  Fly   246 SCHLSNTICNNAFIMFANGGYVNANASSMSVLIETHPAGSSSNQGIHY-------------LQLW 297
            |...:...|..|..::...|:::..::::. ..:.|......:..|:|             ::.|
Yeast   186 SLECNKRKCGGAVALYFANGFLSVKSNNVH-QAQLHYEQQQHDPYINYSMPLSSMPNLLDEVKKW 249

  Fly   298 KSLKFRQYDW---GTKKNNELYGQDLPP-----DYDLSKIVAP----THLYSSTNDALCGPEDVN 350
            ..|. .|.|:   ||.....|:.:.|..     ||.|.:...|    ....:..|..|..|||..
Yeast   250 PDLS-NQRDFFQKGTASRKVLFMKGLQSNFINNDYSLLRYNFPCADVREFNTGHNLLLENPEDSF 313

  Fly   351 TLVENF 356
            ..:.||
Yeast   314 KCILNF 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
magNP_649229.1 Abhydro_lipase 34..94 CDD:282003 7/21 (33%)
MhpC 56..366 CDD:223669 68/331 (21%)
Abhydrolase_5 76..>197 CDD:289465 34/141 (24%)
EAT1NP_011529.1 Abhydrolase_1 39..309 CDD:395444 61/316 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.