DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mag and ABHD11

DIOPT Version :9

Sequence 1:NP_649229.1 Gene:mag / 40267 FlyBaseID:FBgn0036996 Length:399 Species:Drosophila melanogaster
Sequence 2:XP_024302717.1 Gene:ABHD11 / 83451 HGNCID:16407 Length:434 Species:Homo sapiens


Alignment Length:64 Identity:14/64 - (21%)
Similarity:24/64 - (37%) Gaps:17/64 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 DWHEIGTIDI---------PAM--------IDYILADTGFDQIHYAGHSQGTTVYLVMLSERPE 184
            :|.::.|:|.         |.|        :..:|...|.......|||.|....:::..:|||
Human   212 EWPQVLTVDARNHGDSPHSPDMSYEIMSQDLQDLLPQLGLVPCVVVGHSMGGKTAMLLALQRPE 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
magNP_649229.1 Abhydro_lipase 34..94 CDD:282003
MhpC 56..366 CDD:223669 14/64 (22%)
Abhydrolase_5 76..>197 CDD:289465 14/64 (22%)
ABHD11XP_024302717.1 Atrophin-1 <15..159 CDD:331285
PRK10673 216..433 CDD:331147 13/60 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.