DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mag and CG14717

DIOPT Version :9

Sequence 1:NP_649229.1 Gene:mag / 40267 FlyBaseID:FBgn0036996 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001262481.1 Gene:CG14717 / 41412 FlyBaseID:FBgn0265271 Length:306 Species:Drosophila melanogaster


Alignment Length:126 Identity:23/126 - (18%)
Similarity:51/126 - (40%) Gaps:21/126 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 RIPYSHKLKNQNE-KRPPILLQHGLFSNSDCWLSSGPDNSLAYLLADAGYDVWLGNARGNIYSRN 123
            |:.|......:|: :.|||::.|.|..:.:.|      ..:|..|:..|....:     .:.:||
  Fly    30 RLEYVSYTSPRNQMQAPPIVVMHDLNLSLESW------RQVAVNLSQVGLRQVI-----TVDARN 83

  Fly   124 NIIISLNSHKFWHFDWHEIGTIDIPAMIDYILADTGFDQIHYAGHSQGTTVYLVMLSERPE 184
            :   .|:.:...|...|      :.|.::.:::....::|...||..|....:.:...:|:
  Fly    84 H---GLSPYITGHSPMH------LAADVEALMSHQRLNKIVALGHGMGGRAMMTLALTQPQ 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
magNP_649229.1 Abhydro_lipase 34..94 CDD:282003 9/34 (26%)
MhpC 56..366 CDD:223669 23/126 (18%)
Abhydrolase_5 76..>197 CDD:289465 19/109 (17%)
CG14717NP_001262481.1 MhpC 28..299 CDD:223669 23/126 (18%)
Abhydrolase_5 47..>165 CDD:289465 19/109 (17%)
Abhydrolase <249..301 CDD:304388
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.