DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mag and Abhd11

DIOPT Version :9

Sequence 1:NP_649229.1 Gene:mag / 40267 FlyBaseID:FBgn0036996 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001258109.1 Gene:Abhd11 / 360831 RGDID:1304681 Length:307 Species:Rattus norvegicus


Alignment Length:255 Identity:53/255 - (20%)
Similarity:83/255 - (32%) Gaps:77/255 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 IPYSHKLKNQNEKRPPILLQHGLFSNSDCWLSSGPDNSLAYLLAD-AGYDVWLGNARGNIYSRNN 124
            :|.|:.|.:.:...|.|:|.||||.      |....||||..|.. .|..|...:||.       
  Rat    45 LPLSYNLLDGDATLPAIVLLHGLFG------SKSNFNSLAKALVQRTGRRVLTVDARN------- 96

  Fly   125 IIISLNSHKFWHFDWHEIGTIDIPAM---IDYILADTGFDQIHYAGHSQGTTVYLVMLSERPEYN 186
                       |.|..........||   :..:|...|.......|||.|....:::..:||:..
  Rat    97 -----------HGDSPHSPDASYEAMSQDLQGLLPQLGLVPSVLVGHSMGGKTAMLLALQRPDVV 150

  Fly   187 ALIKSGHLLAPCAFFEHGTSFIFNALGPLVGTPGGIWNQLL-----VDTELIPNN---NLVNRLV 243
            ..:                  :...:.|...|||......:     ||   ||.|   :...:|.
  Rat   151 ERL------------------VVVDISPAGTTPGSYLGNFIAAMKAVD---IPENIPHSRARKLA 194

  Fly   244 DNSCHLSNTICNNAFIMF-------ANGGY---VNANASSMSV--------LIETHPAGS 285
            |.  .||:.:...:...|       .||.:   ||.:|.:..:        .:|::|..:
  Rat   195 DE--QLSSVVKEASVRQFLLTNLVEVNGRFSWRVNLDALAQQLDKILTFPQQLESYPGST 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
magNP_649229.1 Abhydro_lipase 34..94 CDD:282003 11/32 (34%)
MhpC 56..366 CDD:223669 53/255 (21%)
Abhydrolase_5 76..>197 CDD:289465 28/124 (23%)
Abhd11NP_001258109.1 Abhydrolase_5 60..195 CDD:289465 38/179 (21%)
PRK10673 61..307 CDD:182637 49/239 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.