DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mag and CG17097

DIOPT Version :9

Sequence 1:NP_649229.1 Gene:mag / 40267 FlyBaseID:FBgn0036996 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_609429.1 Gene:CG17097 / 34461 FlyBaseID:FBgn0265264 Length:1087 Species:Drosophila melanogaster


Alignment Length:368 Identity:132/368 - (35%)
Similarity:198/368 - (53%) Gaps:22/368 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 IRSHGYPTETHEVTTQDGYVLTLFRIPYSHKLKNQNEKRP---PILLQHGLFSNSDCWLSSGPDN 97
            |..:|||:||:.||::|||.|.|.|||           ||   |:||.|||.::|..|:..||.:
  Fly   730 IEKYGYPSETNYVTSEDGYRLCLHRIP-----------RPGAEPVLLVHGLMASSASWVELGPKD 783

  Fly    98 SLAYLLADAGYDVWLGNARGNIYSRNNIIISLNSHKFWHFDWHEIGTIDIPAMIDYILADTGFDQ 162
            .|||:|...|||||:.|.|||||||.|:...|..:|:|.|.:||||..|:||.||:||..|...:
  Fly   784 GLAYILYRKGYDVWMLNTRGNIYSRENLNRRLKPNKYWDFSFHEIGKFDVPAAIDHILIHTHKPK 848

  Fly   163 IHYAGHSQGTTVYLVMLSERPEYNALIKSGHLLAPCAFFEHGTSFIFNALGPLVGTPGGIWNQLL 227
            |.|.|||||:||:.||.||||.|...:.....|:|..:.:...|.:...||...|....:.| ||
  Fly   849 IQYIGHSQGSTVFFVMCSERPNYAHKVNLMQALSPTVYLQENRSPVLKFLGMFKGKYSMLLN-LL 912

  Fly   228 VDTELIPNNNLVNRLVDNSC---HLSNTICNNAFIMFANGGY-VNANASSMSVLIETHPA-GSSS 287
            ...|:.....|:.:...:.|   .|.::||  |...|...|: ..:..::::.::..|.: |:|:
  Fly   913 GGYEISAKTKLIQQFRQHICSGSELGSSIC--AIFDFVLCGFDWKSFNTTLTPIVAAHASQGASA 975

  Fly   288 NQGIHYLQLWKSLKFRQYDWGTKKNNELYGQDLPPDYDLSKIVAPTHLYSSTNDALCGPEDVNTL 352
            .|..||.||...|.|:::|.|...|...|....||.|:||:..:...|:....|.|....||..|
  Fly   976 KQIYHYAQLQGDLNFQRFDHGAVLNRVRYESSEPPAYNLSQTTSKVVLHHGEGDWLGSTSDVIRL 1040

  Fly   353 VENFPHLTEDYRVPVQSFNHLDFIIAKNMKELVNDPIIERINS 395
            .|..|:|.|..:|..:.|:|.||.::|:::.|:...::..:::
  Fly  1041 QERLPNLVESRKVNFEGFSHFDFTLSKDVRPLLYSHVLRHLST 1083

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
magNP_649229.1 Abhydro_lipase 34..94 CDD:282003 26/60 (43%)
MhpC 56..366 CDD:223669 114/317 (36%)
Abhydrolase_5 76..>197 CDD:289465 61/120 (51%)
CG17097NP_609429.1 Abhydro_lipase 726..780 CDD:282003 26/60 (43%)
MhpC 746..1061 CDD:223669 119/328 (36%)
Abhydrolase_5 762..>899 CDD:289465 63/136 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439501
Domainoid 1 1.000 150 1.000 Domainoid score I1414
eggNOG 1 0.900 - - E2759_KOG2624
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D39202at50557
OrthoFinder 1 1.000 - - FOG0000083
OrthoInspector 1 1.000 - - otm46497
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11005
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.