DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mag and LIPJ

DIOPT Version :9

Sequence 1:NP_649229.1 Gene:mag / 40267 FlyBaseID:FBgn0036996 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001010939.2 Gene:LIPJ / 142910 HGNCID:21773 Length:366 Species:Homo sapiens


Alignment Length:368 Identity:125/368 - (33%)
Similarity:199/368 - (54%) Gaps:30/368 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 GYPTETHEVTTQDGYVLTLFRIPYSHKLKNQN-EKRPPILLQHGLFSNSDCWLSSGPDNSLAYLL 103
            |||.|.:::.|:|||:|.|:||||.....|:| .:|..:.|||||.:::..|:|:.|:|||.::|
Human    11 GYPDEEYDIVTEDGYILGLYRIPYWRTDNNKNLAQRVVVYLQHGLLTSASSWISNLPNNSLGFIL 75

  Fly   104 ADAGYDVWLGNARGNIYSRNNIIISLNSHKFWHFDWHEIGTIDIPAMIDYILADTGFDQIHYAGH 168
            ||||||||:||:|||.:||.::.:..:|.:||.|.:.|:...|:||.||:.:..|..::|.|.||
Human    76 ADAGYDVWMGNSRGNTWSRKHLYLETSSKEFWAFSFDEMAKYDLPASIDFTVKQTRQEEIFYVGH 140

  Fly   169 SQGTTVYLVMLSERPEYNALIKSGHLLAPCAFFEHGTSFIFNALGPLVGTPGGIWNQLLV----D 229
            |||||:..:..|...:....||....|||.    ..|.::   ..||:..... |..:::    :
Human   141 SQGTTIGFITFSTISKIAERIKIFFALAPV----FSTKYL---KSPLIRMTYK-WKSIVMAFSGN 197

  Fly   230 TELIPNNNLVNRLVDNSCHLS--NTIC-NNAFIMFANGGY--VNANASSMSVLIETHPAGSSSNQ 289
            .:.:|..:....:....|.|.  :.|| |..|:||   ||  .|.|.|.:.|....:|||:|...
Human   198 KDFLPKTSFKKFIGSKLCPLQIFDKICLNILFMMF---GYDPKNLNMSRLDVYFSHNPAGTSVQN 259

  Fly   290 GIHYLQLWKSLKFRQYDWGTKKNNEL-YGQDLPPDYDLSKIVAPTHLYSSTNDALCGPEDVNTL- 352
            .:|:.||..|...:.||||:...|.: |.|...|.|:::.:...|.:::..:|.|..|||||.| 
Human   260 MLHWSQLLNSTHLKAYDWGSPDLNLVHYNQTTSPLYNMTNMNVATAIWNGKSDLLADPEDVNILH 324

  Fly   353 --VENFPHLTEDYRVPVQSFNHLDFIIAKNMKELVNDPIIERI 393
              :.|  |:   |...:..:||:|.:...::.:.|...||:.|
Human   325 SEITN--HI---YYKTISYYNHIDSLFGLDVYDQVYHEIIDII 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
magNP_649229.1 Abhydro_lipase 34..94 CDD:282003 24/54 (44%)
MhpC 56..366 CDD:223669 110/323 (34%)
Abhydrolase_5 76..>197 CDD:289465 51/120 (43%)
LIPJNP_001010939.2 Abhydro_lipase 3..66 CDD:282003 24/54 (44%)
Abhydrolase_5 47..209 CDD:289465 58/169 (34%)
Abhydrolase_1 48..347 CDD:278959 104/314 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141761
Domainoid 1 1.000 222 1.000 Domainoid score I2592
eggNOG 1 0.900 - - E2759_KOG2624
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 271 1.000 Inparanoid score I3005
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55134
OrthoDB 1 1.010 - - D408561at33208
OrthoFinder 1 1.000 - - FOG0000083
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11005
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X80
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1110.910

Return to query results.
Submit another query.