DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IGLON5 and DIP-iota

DIOPT Version :9

Sequence 1:NP_001094842.1 Gene:IGLON5 / 402665 HGNCID:34550 Length:336 Species:Homo sapiens
Sequence 2:NP_001097100.1 Gene:DIP-iota / 33925 FlyBaseID:FBgn0031837 Length:376 Species:Drosophila melanogaster


Alignment Length:285 Identity:93/285 - (32%)
Similarity:138/285 - (48%) Gaps:23/285 - (8%)


- Green bases have known domain annotations that are detailed below.


Human    34 EFNSPADNYTVCEGDNATLSCFIDEHVT-RVAWL--NRSNILYAGNDRWTSDPRVRLLINTPEEF 95
            :|:.|.:|.||..|.:|.|:|.:.:.|: :||||  :...||...|...|.:.|:.:.......:
  Fly    32 KFSGPINNSTVPVGRDALLTCVVHDLVSFKVAWLRVDTQTILSIQNHVITKNHRISISHTEHRIW 96

Human    96 SILITEVGLGDEGLYTCSFQTRHQPYTTQV-YLIVHVPARIVN--ISSPVTVNEGGNVNLLCLAV 157
            .:.|.:|...|.|.|.|...|  .|..:|: ||.|.||..||:  .|..|..:.|.||.|.|.|.
  Fly    97 QLKIRDVQESDRGWYMCQINT--DPMKSQMGYLDVVVPPDIVDYQTSQDVVRSTGQNVTLTCSAT 159

Human   158 GRPEPTVTWRQL------------RDGFTSEGEILEISDIQRGQAGEYECVTHNGVNSAPDSRRV 210
            |.|.||:|||:.            |:.|:.||:.|.:..:||...|.|.|:..|||.... |:||
  Fly   160 GVPMPTITWRREEATPILISDDGDREVFSVEGQNLTLWQVQRSHMGAYLCIASNGVPPTV-SKRV 223

Human   211 LVTVNYPPTI-TDVTSARTALGRAALLRCEAMAVPPADFQWYKDDRLLSSGTAEGLKV-QTERTR 273
            ::.||:.||| |...:....||:...|.|...:.|.:...|.:|.:||..|:.|.:.| ...|..
  Fly   224 MLVVNFAPTIWTRYDTIYVGLGQKLTLECITESQPASVNFWLRDSQLLQGGSYESVSVDHVFRIV 288

Human   274 SMLLFANVSARHYGNYTCRAANRLG 298
            ..:....::.|.:|.|.|||.|.:|
  Fly   289 MRITLRPITKRDFGEYICRAKNAMG 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IGLON5NP_001094842.1 Ig 41..129 CDD:416386 28/91 (31%)
Ig strand A' 41..46 CDD:409353 3/4 (75%)
Ig strand B 48..56 CDD:409353 3/7 (43%)
CDR1 56..60 CDD:409353 0/3 (0%)
FR2 61..68 CDD:409353 4/9 (44%)
Ig strand C 61..67 CDD:409353 4/8 (50%)
CDR2 69..79 CDD:409353 3/9 (33%)
Ig strand C' 71..74 CDD:409353 2/2 (100%)
Ig strand C' 76..79 CDD:409353 1/2 (50%)
FR3 80..115 CDD:409353 8/34 (24%)
Ig strand D 84..91 CDD:409353 1/6 (17%)
Ig strand E 94..100 CDD:409353 0/5 (0%)
Ig strand F 107..115 CDD:409353 3/7 (43%)
CDR3 116..120 CDD:409353 1/3 (33%)
Ig strand G 120..129 CDD:409353 4/9 (44%)
FR4 122..129 CDD:409353 3/7 (43%)
Ig_3 134..199 CDD:404760 27/78 (35%)
Ig strand B 148..157 CDD:409353 4/8 (50%)
Ig strand C 162..170 CDD:409353 5/19 (26%)
Ig strand F 191..199 CDD:409353 3/7 (43%)
Ig strand G 202..212 CDD:409353 3/9 (33%)
Ig_3 217..295 CDD:404760 23/79 (29%)
putative Ig strand A 218..224 CDD:409353 4/6 (67%)
Ig strand B 234..238 CDD:409353 1/3 (33%)
Ig strand C 247..251 CDD:409353 0/3 (0%)
Ig strand E 274..278 CDD:409353 0/3 (0%)
Ig strand F 288..293 CDD:409353 2/4 (50%)
Ig strand G 301..304 CDD:409353
DIP-iotaNP_001097100.1 IG_like 39..125 CDD:214653 26/87 (30%)
Ig 39..122 CDD:299845 25/84 (30%)
Ig 132..213 CDD:299845 28/80 (35%)
IG_like 141..227 CDD:214653 31/86 (36%)
IG_like 239..322 CDD:214653 21/75 (28%)
IGc2 245..313 CDD:197706 19/67 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143464
Domainoid 1 1.000 59 1.000 Domainoid score I10656
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 141 1.000 Inparanoid score I4481
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 1 1.000 - - mtm8497
orthoMCL 1 0.900 - - OOG6_117834
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R8421
SonicParanoid 1 1.000 - - X97
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1211.730

Return to query results.
Submit another query.