DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IGLON5 and iglon5

DIOPT Version :9

Sequence 1:NP_001094842.1 Gene:IGLON5 / 402665 HGNCID:34550 Length:336 Species:Homo sapiens
Sequence 2:XP_002938252.1 Gene:iglon5 / 100488314 XenbaseID:XB-GENE-945713 Length:333 Species:Xenopus tropicalis


Alignment Length:325 Identity:202/325 - (62%)
Similarity:261/325 - (80%) Gaps:7/325 - (2%)


- Green bases have known domain annotations that are detailed below.


Human     8 ARLRLLAAAALAGLAVISRGLLSQSLEFNSPADNYTVCEGDNATLSCFIDEHVTRVAWLNRSNIL 72
            |.|:.::.|:| |:.::::.|..|..||..|||||||.:||||||||.||:.|||||||||||||
 Frog     3 APLQRVSLASL-GIVMLAQVLFVQCTEFVPPADNYTVSQGDNATLSCLIDDKVTRVAWLNRSNIL 66

Human    73 YAGNDRWTSDPRVRLLINTPEEFSILITEVGLGDEGLYTCSFQTRHQPYTTQVYLIVHVPARIVN 137
            |||.|:|:.|.||:||.||..|:||:||.|.:.|||||||||||..:|:|:||||||.|||:|||
 Frog    67 YAGKDKWSIDSRVQLLTNTKSEYSIVITHVDVADEGLYTCSFQTEDKPHTSQVYLIVQVPAKIVN 131

Human   138 ISSPVTVNEGGNVNLLCLAVGRPEPTVTWRQLRDGFTSEGEILEISDIQRGQAGEYECVTHNGVN 202
            |||.||||||.||||.|||||:||||:||:||.:||:||||:|||::|.|.|||:|||||.||| 
 Frog   132 ISSSVTVNEGSNVNLQCLAVGKPEPTITWQQLSEGFSSEGELLEITEINRQQAGDYECVTSNGV- 195

Human   203 SAPDSRRVLVTVNYPPTITDVTSARTALGRAALLRCEAMAVPPADFQWYKDD-RLLSSGTAEGLK 266
            |.||:::|.:||||||.||||.:|::.:||.|.|||:|||||||:|:||||: |.|.||| |||.
 Frog   196 SVPDTKKVQITVNYPPYITDVKNAQSPVGRPATLRCKAMAVPPAEFEWYKDEKRRLISGT-EGLS 259

Human   267 VQTERTRSMLLFANVSARHYGNYTCRAANRLGASSASMRLLRPGSLENSAPR---PPGLLALLSA 328
            ::||.:.|:::|:||::||||||||.|:|:||:.::|:|||:||...|....   .|.||.|||:
 Frog   260 IKTESSWSVIVFSNVTSRHYGNYTCLASNKLGSFNSSLRLLKPGDPLNQGATHMVSPLLLGLLSS 324

Human   329  328
             Frog   325  324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IGLON5NP_001094842.1 Ig 41..129 CDD:416386 62/87 (71%)
Ig strand A' 41..46 CDD:409353 4/4 (100%)
Ig strand B 48..56 CDD:409353 7/7 (100%)
CDR1 56..60 CDD:409353 2/3 (67%)
FR2 61..68 CDD:409353 6/6 (100%)
Ig strand C 61..67 CDD:409353 5/5 (100%)
CDR2 69..79 CDD:409353 8/9 (89%)
Ig strand C' 71..74 CDD:409353 2/2 (100%)
Ig strand C' 76..79 CDD:409353 1/2 (50%)
FR3 80..115 CDD:409353 21/34 (62%)
Ig strand D 84..91 CDD:409353 4/6 (67%)
Ig strand E 94..100 CDD:409353 3/5 (60%)
Ig strand F 107..115 CDD:409353 7/7 (100%)
CDR3 116..120 CDD:409353 1/3 (33%)
Ig strand G 120..129 CDD:409353 6/8 (75%)
FR4 122..129 CDD:409353 5/6 (83%)
Ig_3 134..199 CDD:404760 48/64 (75%)
Ig strand B 148..157 CDD:409353 6/8 (75%)
Ig strand C 162..170 CDD:409353 5/7 (71%)
Ig strand F 191..199 CDD:409353 6/7 (86%)
Ig strand G 202..212 CDD:409353 4/9 (44%)
Ig_3 217..295 CDD:404760 48/78 (62%)
putative Ig strand A 218..224 CDD:409353 4/5 (80%)
Ig strand B 234..238 CDD:409353 2/3 (67%)
Ig strand C 247..251 CDD:409353 1/3 (33%)
Ig strand E 274..278 CDD:409353 1/3 (33%)
Ig strand F 288..293 CDD:409353 4/4 (100%)
Ig strand G 301..304 CDD:409353 0/2 (0%)
iglon5XP_002938252.1 Ig 31..123 CDD:299845 65/91 (71%)
IG_like 35..123 CDD:214653 62/87 (71%)
Ig 126..207 CDD:299845 57/81 (70%)
I-set 128..207 CDD:254352 55/79 (70%)
I-set 210..299 CDD:254352 52/89 (58%)
Ig 227..298 CDD:143165 43/71 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 133 1.000 Domainoid score I23770
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H46295
Inparanoid 1 1.050 401 1.000 Inparanoid score I9072
NCBI 1 1.000 - -
OMA 1 1.010 - - QHG43105
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 1 1.000 - - oto150611
Panther 1 1.100 - - LDO PTHR42757
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R8421
SonicParanoid 1 1.000 - - X97
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1313.110

Return to query results.
Submit another query.