DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment atk and AT1G33590

DIOPT Version :10

Sequence 1:NP_649228.1 Gene:atk / 40266 FlyBaseID:FBgn0036995 Length:1535 Species:Drosophila melanogaster
Sequence 2:NP_001323401.1 Gene:AT1G33590 / 840253 AraportID:AT1G33590 Length:514 Species:Arabidopsis thaliana


Alignment Length:536 Identity:129/536 - (24%)
Similarity:181/536 - (33%) Gaps:167/536 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   364 DMSGNLLSELPYGALRGHGTLEQLHLNHNHLRLIE-----------RDALMAMPALRELRMRNNS 417
            |::|:.||          |||........||..|.           ...|..:|.|:.:.:.||.
plant   120 DVAGSFLS----------GTLSPSLAKLKHLDGIYFTDLKNITGSFPQFLFQLPNLKYVYIENNR 174

  Fly   418 LSSDLPLPFWNLPGLKGLDLAQNQFARVDSQLLAGLPSLRRLDLSENGLIELAPNSFRHNPLLET 482
            ||..||.....|..|:...|..|:|.......::.|..|.:|.|..|.|....|....:..|:..
plant   175 LSGTLPANIGALSQLEAFSLEGNRFTGPIPSSISNLTLLTQLKLGNNLLTGTIPLGVANLKLMSY 239

  Fly   483 LNISSNELTKIHSSTLIHLERLFEVDASYNQLKSVIAGLPRIVERISLKGNQITSLPAAASKDLQ 547
            ||:..|.||                           ..:|.|.:                    .
plant   240 LNLGGNRLT---------------------------GTIPDIFK--------------------S 257

  Fly   548 LPNLRMLDLSQNRIEQLPRHGFQGAMELRVLSLAQNELRQLKDTSFIGIQRLELLHLQENQLGEA 612
            :|.||.|.||:|        ||.|.:...:.|||                               
plant   258 MPELRSLTLSRN--------GFSGNLPPSIASLA------------------------------- 283

  Fly   613 DERALLPLAELRNLNLQSNKLEAITDNFFSNNSRLEQLDLSRNLIRSISPTAFDTQRSLEYLDLS 677
                  |:  ||.|.|..|||.....||.||...|:.||||:|....:.|.:|.....:..||||
plant   284 ------PI--LRFLELGHNKLSGTIPNFLSNFKALDTLDLSKNRFSGVIPKSFANLTKIFNLDLS 340

  Fly   678 GNALLDISVGLGNLNNLRDIDLSYNQISRIQSDVIGGWRNVVEIRLSNNLI---VELQQGTFRNL 739
            .|.|.|....| |:..:..:||||||   ...:.|..|.....|..|..|.   :::....::..
plant   341 HNLLTDPFPVL-NVKGIESLDLSYNQ---FHLNTIPKWVTSSPIIFSLKLAKCGIKMSLDDWKPA 401

  Fly   740 PKLQY--LDLSSNEIRNVEPGALKGLDELQEFVLADNKLVELKDHVFEELPSLLASHFQYNKLRY 802
            ....|  :|||.|||.......|...:.|.||..|.|||                 .|...||.:
plant   402 QTFYYDFIDLSENEITGSPARFLNQTEYLVEFKAAGNKL-----------------RFDMGKLTF 449

  Fly   803 ISPESFHNANSLVFLNLSNN-HFRNMENIGLRSMRNLEVLDLSTN---GVKLVSTMPLKALNWLV 863
                    |.:|..|::|.| .|..:..:    :..|:.|::|.|   |...|:..|..|.    
plant   450 --------AKTLTTLDISRNLVFGKVPAM----VAGLKTLNVSHNHLCGKLPVTKFPASAF---- 498

  Fly   864 ELKMDNNQICRIQGSP 879
               :.|:.:|   |||
plant   499 ---VGNDCLC---GSP 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atkNP_649228.1 leucine-rich repeat 886..906 CDD:275380
PCC 891..>936 CDD:188093
leucine-rich repeat 69..89 CDD:275380
leucine-rich repeat 90..113 CDD:275380
LRR 93..530 CDD:443914 39/176 (22%)
leucine-rich repeat 115..138 CDD:275380
leucine-rich repeat 139..160 CDD:275380
leucine-rich repeat 161..184 CDD:275380
leucine-rich repeat 185..209 CDD:275380
leucine-rich repeat 210..233 CDD:275380
leucine-rich repeat 234..259 CDD:275380
leucine-rich repeat 260..283 CDD:275380
leucine-rich repeat 284..307 CDD:275380
leucine-rich repeat 308..359 CDD:275380
leucine-rich repeat 334..348 CDD:275378
PLN00113 359..>824 CDD:215061 115/476 (24%)
leucine-rich repeat 360..383 CDD:275380 4/18 (22%)
leucine-rich repeat 384..407 CDD:275380 5/33 (15%)
leucine-rich repeat 408..431 CDD:275380 8/22 (36%)
leucine-rich repeat 432..455 CDD:275380 5/22 (23%)
leucine-rich repeat 456..476 CDD:275380 6/19 (32%)
leucine-rich repeat 480..501 CDD:275380 5/20 (25%)
leucine-rich repeat 505..517 CDD:275378 0/11 (0%)
leucine-rich repeat 525..550 CDD:275380 0/24 (0%)
leucine-rich repeat 551..574 CDD:275380 9/22 (41%)
leucine-rich repeat 575..598 CDD:275380 3/22 (14%)
leucine-rich repeat 599..622 CDD:275380 1/22 (5%)
leucine-rich repeat 623..646 CDD:275380 11/22 (50%)
leucine-rich repeat 647..670 CDD:275380 8/22 (36%)
leucine-rich repeat 671..693 CDD:275380 9/21 (43%)
leucine-rich repeat 694..717 CDD:275380 8/22 (36%)
leucine-rich repeat 718..741 CDD:275380 3/25 (12%)
leucine-rich repeat 742..763 CDD:275380 8/22 (36%)
leucine-rich repeat 766..789 CDD:275380 7/22 (32%)
leucine-rich repeat 790..813 CDD:275380 4/22 (18%)
leucine-rich repeat 814..835 CDD:275380 5/21 (24%)
leucine-rich repeat 838..861 CDD:275380 8/25 (32%)
leucine-rich repeat 862..885 CDD:275380 5/18 (28%)
AT1G33590NP_001323401.1 PLN00113 44..>513 CDD:215061 129/536 (24%)
leucine-rich repeat 165..188 CDD:275380 8/22 (36%)
leucine-rich repeat 189..212 CDD:275380 5/22 (23%)
leucine-rich repeat 213..236 CDD:275380 6/22 (27%)
leucine-rich repeat 237..260 CDD:275380 7/69 (10%)
leucine-rich repeat 261..285 CDD:275380 12/68 (18%)
leucine-rich repeat 286..309 CDD:275380 11/22 (50%)
leucine-rich repeat 310..333 CDD:275380 8/22 (36%)
leucine-rich repeat 381..406 CDD:275380 2/24 (8%)
leucine-rich repeat 430..452 CDD:275380 11/46 (24%)
leucine-rich repeat 453..474 CDD:275380 5/24 (21%)
leucine-rich repeat 475..503 CDD:275380 8/34 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.