DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment atk and RLP45

DIOPT Version :10

Sequence 1:NP_649228.1 Gene:atk / 40266 FlyBaseID:FBgn0036995 Length:1535 Species:Drosophila melanogaster
Sequence 2:NP_001325565.1 Gene:RLP45 / 824491 AraportID:AT3G53240 Length:927 Species:Arabidopsis thaliana


Alignment Length:876 Identity:205/876 - (23%)
Similarity:332/876 - (37%) Gaps:223/876 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 IGINLIRAESCPPSQAILPCRCSLRGKEIQIWCSHSNLPQI----------MDGLKAVERNIKGR 66
            |||:|......||..                      |||:          :..|.......||.
plant    59 IGISLSLESIRPPDP----------------------LPQLNLTFFYPFEELQSLNLSSGYFKGW 101

  Fly    67 IDELVLENNQLPALPGRFFGSLQ-IVRLMLRHNSIERVSNGWLNE--------LENGLVE-IFVV 121
            .||         ...|:..|||: :..|.|..|..:.....:|||        |.:.|.: .|.|
plant   102 FDE---------RKGGKGLGSLRNLETLDLGVNFYDTSVLPYLNEAVSLKTLILHDNLFKGGFPV 157

  Fly   122 EPQLRSIPAESLNGMINMLAITIQSEELKHLPDFSGL-LSLTYLSVQTGALQELPSHLFRHLPKL 185
            :..:.....|.|:...|..:..:.::||.:|.:...| ||....|   |:||:  ..:.| |.:|
plant   158 QELINLTSLEVLDLKFNKFSGQLPTQELTNLRNLRALDLSNNKFS---GSLQK--QGICR-LEQL 216

  Fly   186 QHIHITGGSGLTRLEAGLFDGLI--------SLKNLDLSHNGLNWIHLRALSRLPNLVS------ 236
            |.:         ||....|:|.|        .|:.||||.|.|:       .::|..:|      
plant   217 QEL---------RLSRNRFEGEIPLCFSRFSKLRVLDLSSNHLS-------GKIPYFISDFKSME 265

  Fly   237 -LKLSHNQISDVGMVGRIVKDLEHLK--KLRLDNNLITVIE----DGSFVDLPNLSELHLNDNRI 294
             |.|..|....:..:| ::.:|..||  ||...:.::.::|    .|....|.::...|.|..:|
plant   266 YLSLLDNDFEGLFSLG-LITELTELKVFKLSSRSGMLQIVETNVSGGLQSQLSSIMLSHCNLGKI 329

  Fly   295 TELQYGAFLRTPQLKTIYLQNNLIRRIHPESLLQASGSGVEAVHMYNNEIGHVEALRALLDALPR 359
            .    |......:|:.|.|.||::..:.|..||: :.:.::|:.:.||....:...|    .:.|
plant   330 P----GFLWYQQELRVIDLSNNILSGVFPTWLLE-NNTELQALLLQNNSFKTLTLPR----TMRR 385

  Fly   360 LRYLDMS-GNLLSELPYGALRGHGTLEQLHLNHNHLRLIERDALMAMPALRELRMRNNSLSSDLP 423
            |:.||:| .|..::||                        :|..:.:.:||.|.:.||....::|
plant   386 LQILDLSVNNFNNQLP------------------------KDVGLILASLRHLNLSNNEFLGNMP 426

  Fly   424 LPFWNLPGLKGLDLAQNQFA-RVDSQLLAGLPSLRRLDLSENGLIELAPNSFRHNPLLETLNISS 487
            .....:..::.:||:.|.|: ::...|..|..||..|.||.|...............|.||.:.:
plant   427 SSMARMENIEFMDLSYNNFSGKLPRNLFTGCYSLSWLKLSHNRFSGPIIRKSSDETSLITLIMDN 491

  Fly   488 NELTKIHSSTLIHLERLFEVDASYNQLKSVIAGLPR-------IVERIS---------------- 529
            |..|.....||::|..|..:|.|.|.|...|   ||       .|.|||                
plant   492 NMFTGKIPRTLLNLRMLSVIDLSNNLLTGTI---PRWLGNFFLEVLRISNNRLQGAIPPSLFNIP 553

  Fly   530 ------LKGNQIT-SLPAAASKD----LQLPN--------------LRMLDLSQNRIE-QLPRHG 568
                  |.||.:: |||..:|.|    |.|.|              ||:|||..|::. .:|.  
plant   554 YLWLLDLSGNFLSGSLPLRSSSDYGYILDLHNNNLTGSIPDTLWYGLRLLDLRNNKLSGNIPL-- 616

  Fly   569 FQGAMELRVLSLAQNELRQLKDTSFIGIQRLELLHLQENQLGEADERALLPL-----------AE 622
            |:....:.|:.|.:|.|.........|:..:.:|....|:|.|:....:..|           ::
plant   617 FRSTPSISVVLLRENNLTGKIPVELCGLSNVRMLDFAHNRLNESIPSCVTNLSFGSGGHSNADSD 681

  Fly   623 LRNLNLQSNKLEAITDNFFSNNSRLEQLDLSRNLIRSISPTAFDTQRSLEYLDLSGNALLDISVG 687
            ....:|.||.:|..|:.::      |.|.:|...             ||:| .:..|..::.:|.
plant   682 WYPASLLSNFMEIYTEVYY------ESLIVSDRF-------------SLDY-SVDFNVQVEFAVK 726

  Fly   688 -------LGNLNNLRDIDLSYNQISRIQSDVIGGWRNVVEIRLSNNLIVELQQGTFRNLPKLQYL 745
                   .|.||.:..:|||.|::|....:.:|..:.|..:.||.|.:.....|:|.||..::.|
plant   727 QRYDLYMRGTLNQMFGLDLSSNELSGNIPEELGDLKRVRSLNLSRNSLSGSIPGSFSNLRSIESL 791

  Fly   746 DLSSNEIRNVEPGALKGLDELQEFVLADNKL 776
            |||.|::....|..|..|..|..|.::.|.|
plant   792 DLSFNKLHGTIPSQLTLLQSLVVFNVSYNNL 822

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atkNP_649228.1 leucine-rich repeat 886..906 CDD:275380
PCC 891..>936 CDD:188093
leucine-rich repeat 69..89 CDD:275380 4/19 (21%)
leucine-rich repeat 90..113 CDD:275380 7/30 (23%)
LRR 93..530 CDD:443914 116/498 (23%)
leucine-rich repeat 115..138 CDD:275380 5/23 (22%)
leucine-rich repeat 139..160 CDD:275380 4/21 (19%)
leucine-rich repeat 161..184 CDD:275380 6/22 (27%)
leucine-rich repeat 185..209 CDD:275380 7/31 (23%)
leucine-rich repeat 210..233 CDD:275380 7/22 (32%)
leucine-rich repeat 234..259 CDD:275380 6/31 (19%)
leucine-rich repeat 260..283 CDD:275380 7/28 (25%)
leucine-rich repeat 284..307 CDD:275380 4/22 (18%)
leucine-rich repeat 308..359 CDD:275380 12/50 (24%)
leucine-rich repeat 334..348 CDD:275378 3/13 (23%)
PLN00113 359..>824 CDD:215061 118/487 (24%)
leucine-rich repeat 360..383 CDD:275380 7/23 (30%)
leucine-rich repeat 384..407 CDD:275380 1/22 (5%)
leucine-rich repeat 408..431 CDD:275380 6/22 (27%)
leucine-rich repeat 432..455 CDD:275380 6/23 (26%)
leucine-rich repeat 456..476 CDD:275380 5/19 (26%)
leucine-rich repeat 480..501 CDD:275380 7/20 (35%)
leucine-rich repeat 505..517 CDD:275378 4/11 (36%)
leucine-rich repeat 525..550 CDD:275380 14/51 (27%)
leucine-rich repeat 551..574 CDD:275380 8/23 (35%)
leucine-rich repeat 575..598 CDD:275380 5/22 (23%)
leucine-rich repeat 599..622 CDD:275380 5/33 (15%)
leucine-rich repeat 623..646 CDD:275380 5/22 (23%)
leucine-rich repeat 647..670 CDD:275380 3/22 (14%)
leucine-rich repeat 671..693 CDD:275380 6/28 (21%)
leucine-rich repeat 694..717 CDD:275380 6/22 (27%)
leucine-rich repeat 718..741 CDD:275380 8/22 (36%)
leucine-rich repeat 742..763 CDD:275380 7/20 (35%)
leucine-rich repeat 766..789 CDD:275380 4/11 (36%)
leucine-rich repeat 790..813 CDD:275380
leucine-rich repeat 814..835 CDD:275380
leucine-rich repeat 838..861 CDD:275380
leucine-rich repeat 862..885 CDD:275380
RLP45NP_001325565.1 LRRNT_2 7..52 CDD:462411
PLN03150 <46..156 CDD:178695 26/127 (20%)
leucine-rich repeat 117..140 CDD:275380 6/22 (27%)
leucine-rich repeat 141..165 CDD:275380 4/23 (17%)
leucine-rich repeat 166..190 CDD:275380 6/23 (26%)
PLN03150 <169..255 CDD:178695 28/107 (26%)
leucine-rich repeat 191..215 CDD:275380 9/29 (31%)
leucine-rich repeat 216..239 CDD:275380 7/31 (23%)
PLN00113 219..>851 CDD:215061 160/679 (24%)
leucine-rich repeat 240..263 CDD:275380 9/29 (31%)
leucine-rich repeat 264..288 CDD:275380 5/24 (21%)
leucine-rich repeat 289..338 CDD:275380 11/52 (21%)
leucine-rich repeat 339..363 CDD:275380 8/24 (33%)
leucine-rich repeat 364..385 CDD:275380 4/24 (17%)
leucine-rich repeat 386..410 CDD:275380 8/47 (17%)
leucine-rich repeat 411..434 CDD:275380 6/22 (27%)
leucine-rich repeat 435..459 CDD:275380 6/23 (26%)
leucine-rich repeat 460..483 CDD:275380 5/22 (23%)
leucine-rich repeat 484..507 CDD:275380 8/22 (36%)
leucine-rich repeat 508..530 CDD:275380 8/24 (33%)
leucine-rich repeat 531..554 CDD:275380 4/22 (18%)
leucine-rich repeat 555..585 CDD:275380 10/29 (34%)
leucine-rich repeat 600..622 CDD:275380 8/23 (35%)
leucine-rich repeat 623..644 CDD:275380 4/20 (20%)
leucine-rich repeat 647..668 CDD:275380 4/20 (20%)
leucine-rich repeat 711..763 CDD:275380 13/52 (25%)
leucine-rich repeat 764..787 CDD:275380 8/22 (36%)
leucine-rich repeat 788..809 CDD:275380 7/20 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.