DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment atk and TLR9

DIOPT Version :10

Sequence 1:NP_649228.1 Gene:atk / 40266 FlyBaseID:FBgn0036995 Length:1535 Species:Drosophila melanogaster
Sequence 2:NP_059138.1 Gene:TLR9 / 54106 HGNCID:15633 Length:1032 Species:Homo sapiens


Alignment Length:148 Identity:31/148 - (20%)
Similarity:58/148 - (39%) Gaps:25/148 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 ENFKSKNLHSERKRRERINQAMYGLRAVVPKITKLNKIGIFSDAVDYINELLVEKQKLEDELKGI 293
            |..|:....:.||.||........||....::.|...:.:    .:|:.|        :::||..
Human    20 ERLKALREKTGRKDREDGEPQTKQLREEGEEVGKHRGLRL----RNYVPE--------DEDLKRR 72

  Fly   294 NEMECKEIAAEE------QSAIADPEAERVS------SKSNKRVKKNEV-KIEVHETGERDFLIR 345
            ...:.|.:|.||      ::|..:|..|.|.      .|.:..:|::.. |:|..|...:..:..
Human    73 RVPQAKPVAVEEKVKEQLEAAKPEPVIEEVDLANLAPRKPDWDLKRDVAKKLEKLEKRTQRAIAE 137

  Fly   346 VVQEHKQDGFKRLIEAVD 363
            :::|..:.....|..|||
Human   138 LIRERLKGQEDSLASAVD 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atkNP_649228.1 leucine-rich repeat 886..906 CDD:275380
PCC 891..>936 CDD:188093
leucine-rich repeat 69..89 CDD:275380
leucine-rich repeat 90..113 CDD:275380
LRR 93..530 CDD:443914 31/148 (21%)
leucine-rich repeat 115..138 CDD:275380
leucine-rich repeat 139..160 CDD:275380
leucine-rich repeat 161..184 CDD:275380
leucine-rich repeat 185..209 CDD:275380
leucine-rich repeat 210..233 CDD:275380 1/3 (33%)
leucine-rich repeat 234..259 CDD:275380 6/24 (25%)
leucine-rich repeat 260..283 CDD:275380 3/22 (14%)
leucine-rich repeat 284..307 CDD:275380 6/28 (21%)
leucine-rich repeat 308..359 CDD:275380 10/57 (18%)
leucine-rich repeat 334..348 CDD:275378 1/13 (8%)
PLN00113 359..>824 CDD:215061 3/5 (60%)
leucine-rich repeat 360..383 CDD:275380 3/4 (75%)
leucine-rich repeat 384..407 CDD:275380
leucine-rich repeat 408..431 CDD:275380
leucine-rich repeat 432..455 CDD:275380
leucine-rich repeat 456..476 CDD:275380
leucine-rich repeat 480..501 CDD:275380
leucine-rich repeat 505..517 CDD:275378
leucine-rich repeat 525..550 CDD:275380
leucine-rich repeat 551..574 CDD:275380
leucine-rich repeat 575..598 CDD:275380
leucine-rich repeat 599..622 CDD:275380
leucine-rich repeat 623..646 CDD:275380
leucine-rich repeat 647..670 CDD:275380
leucine-rich repeat 671..693 CDD:275380
leucine-rich repeat 694..717 CDD:275380
leucine-rich repeat 718..741 CDD:275380
leucine-rich repeat 742..763 CDD:275380
leucine-rich repeat 766..789 CDD:275380
leucine-rich repeat 790..813 CDD:275380
leucine-rich repeat 814..835 CDD:275380
leucine-rich repeat 838..861 CDD:275380
leucine-rich repeat 862..885 CDD:275380
TLR9NP_059138.1 leucine-rich repeat 43..64 CDD:275380 4/24 (17%)
LRR 1 62..85 7/30 (23%)
LRR_8 64..135 CDD:404697 16/78 (21%)
leucine-rich repeat 65..88 CDD:275380 7/30 (23%)
LRR 2 87..110 4/22 (18%)
leucine-rich repeat 89..124 CDD:275380 6/34 (18%)
LRR 113..504 CDD:443914 9/43 (21%)
LRR 3 122..147 4/24 (17%)
leucine-rich repeat 125..144 CDD:275380 3/18 (17%)
leucine-rich repeat 145..168 CDD:275380 4/11 (36%)
LRR 4 150..166 4/6 (67%)
LRR 5 167..190
leucine-rich repeat 169..200 CDD:275380
LRR 6 198..221
leucine-rich repeat 201..221 CDD:275380
leucine-rich repeat 222..245 CDD:275380
LRR 7 223..242
LRR 8 243..268
leucine-rich repeat 246..285 CDD:275380
LRR 9 283..306
leucine-rich repeat 286..307 CDD:275380
LRR 10 308..332
leucine-rich repeat 310..335 CDD:275380
LRR 11 333..356
leucine-rich repeat 336..365 CDD:275380
LRR 12 363..386
leucine-rich repeat 366..392 CDD:275380
LRR 13 390..413
leucine-rich repeat 393..416 CDD:275380
LRR 14 415..440
leucine-rich repeat 417..472 CDD:275380
LRR 15 470..494
leucine-rich repeat 476..497 CDD:275380
LRR 495..>739 CDD:443914
LRR 16 496..519
leucine-rich repeat 498..522 CDD:275380
LRR 17 520..543
leucine-rich repeat 523..546 CDD:275380
LRR 18 545..572
leucine-rich repeat 547..599 CDD:275380
LRR 19 574..598
leucine-rich repeat 600..629 CDD:275380
LRR 20 600..622
LRR 21 627..650
leucine-rich repeat 630..654 CDD:275380
LRR 22 652..675
leucine-rich repeat 655..678 CDD:275380
LRR 23 676..699
leucine-rich repeat 679..702 CDD:275380
LRR 24 701..723
leucine-rich repeat 703..726 CDD:275380
LRR 25 724..747
leucine-rich repeat 727..748 CDD:275380
LRR 26 749..772
leucine-rich repeat 752..770 CDD:275380
SEFIR 870..1009 CDD:474043
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.