DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment atk and Tlr5

DIOPT Version :10

Sequence 1:NP_649228.1 Gene:atk / 40266 FlyBaseID:FBgn0036995 Length:1535 Species:Drosophila melanogaster
Sequence 2:XP_017177186.1 Gene:Tlr5 / 53791 MGIID:1858171 Length:873 Species:Mus musculus


Alignment Length:656 Identity:157/656 - (23%)
Similarity:259/656 - (39%) Gaps:181/656 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   370 LSELPYGALRGHGTLEQLHLNHNHLRLIERDALMAMPALRELRMRNNSLSSDL-PLPFWNLPGLK 433
            |:::|:..   :.|.|:|.|:.|::.::...:...:..|:.|.:.....:..: |..|.|||.|:
Mouse    52 LTQIPWIL---NTTTERLLLSFNYISMVVATSFPLLERLQLLELGTQYANLTIGPGAFRNLPNLR 113

  Fly   434 GLDLAQNQFARVDSQLLAGLPSLRRLDLSENGLIE--LAPNSFRHNPLLETLNISSNEL--TKIH 494
            .|||.|:|...::.....|||.|..|.|...||..  |:...||:...|..|::|.|::  .::|
Mouse   114 ILDLGQSQIEVLNRDAFQGLPHLLELRLFSCGLSSAVLSDGYFRNLYSLARLDLSGNQIHSLRLH 178

  Fly   495 SSTLIHLERLFEVDASYNQLKSV-------IAG---------LPRIVERIS-------------- 529
            || ...|..|.:|:.::||:.::       :.|         |.::..|:|              
Mouse   179 SS-FRELNSLSDVNFAFNQIFTICEDELEPLQGKTLSFFGLKLTKLFSRVSVGWETCRNPFRGVR 242

  Fly   530 ----------------------LKGNQITSL--------PAAASKDLQLP-----------NLRM 553
                                  ::|:||:||        |....::::.|           ::..
Mouse   243 LETLDLSENGWTVDITRNFSNIIQGSQISSLILKHHIMGPGFGFQNIRDPDQSTFASLARSSVLQ 307

  Fly   554 LDLSQNRIEQLPRHGFQGAMELRVLSLAQNELRQLKDTSFIGIQRLELLHLQENQLGEADERALL 618
            ||||...|..|....|....:|::|:||.|::.::.:.:|.|:..|::|:|..|.||        
Mouse   308 LDLSHGFIFSLNPRLFGTLKDLKMLNLAFNKINKIGENAFYGLDSLQVLNLSYNLLG-------- 364

  Fly   619 PLAELRNLNLQSNKLEAITDNFFSNNSRLEQLDLSRNLIRSISPTAFDTQRSLEYLDLSGNALLD 683
               ||.|.|             |....|:..:||.||.|..|....|...::|:.|||..|||..
Mouse   365 ---ELYNSN-------------FYGLPRVAYVDLQRNHIGIIQDQTFRLLKTLQTLDLRDNALKA 413

  Fly   684 ISVGLGNLNNLRDIDLSYNQISRIQSDVIGGWRNVVEIRLSNNLIVELQQGTFRNLPKL----QY 744
            |..                 |..||..::||          |.|:         :||.:    .:
Mouse   414 IGF-----------------IPSIQMVLLGG----------NKLV---------HLPHIHFTANF 442

  Fly   745 LDLSSNEIRNV-EPGALKGLDELQEFVLADNKLVELK-DHVFEELPSLLASHFQYNKLRY----- 802
            |:||.|.:.|: :...|..:.:||..:|..|:|...| .|...|.|||.......|.|:.     
Mouse   443 LELSENRLENLSDLYFLLRVPQLQFLILNQNRLSSCKAAHTPSENPSLEQLFLTENMLQLAWETG 507

  Fly   803 ISPESFHNANSLVFLNLSNNHFRNMENIGLRSMRNLEVLDLSTNGVKLVSTMPLKALNWLVELKM 867
            :..:.|...:.|..|.||||:...:.......:..|.:|.||.|.:.::|...|.|         
Mouse   508 LCWDVFQGLSRLQILYLSNNYLNFLPPGIFNDLVALRMLSLSANKLTVLSPGSLPA--------- 563

  Fly   868 DNNQICRIQGSPFETMPRLRVLSMRNNQLRSIKERTFRNVRGNIAILDVDGNPIDCNCEMQWLSV 932
                             .|.:|.:..|||.|.....|.::|    :||:..|...||||:.....
Mouse   564 -----------------NLEILDISRNQLFSPDPALFSSLR----VLDITHNEFVCNCELSTFIS 607

  Fly   933 WLQETN 938
            ||.:||
Mouse   608 WLNQTN 613

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atkNP_649228.1 leucine-rich repeat 886..906 CDD:275380 7/19 (37%)
PCC 891..>936 CDD:188093 15/44 (34%)
leucine-rich repeat 69..89 CDD:275380
leucine-rich repeat 90..113 CDD:275380
LRR 93..530 CDD:443914 47/216 (22%)
leucine-rich repeat 115..138 CDD:275380
leucine-rich repeat 139..160 CDD:275380
leucine-rich repeat 161..184 CDD:275380
leucine-rich repeat 185..209 CDD:275380
leucine-rich repeat 210..233 CDD:275380
leucine-rich repeat 234..259 CDD:275380
leucine-rich repeat 260..283 CDD:275380
leucine-rich repeat 284..307 CDD:275380
leucine-rich repeat 308..359 CDD:275380
leucine-rich repeat 334..348 CDD:275378
PLN00113 359..>824 CDD:215061 130/540 (24%)
leucine-rich repeat 360..383 CDD:275380 2/12 (17%)
leucine-rich repeat 384..407 CDD:275380 4/22 (18%)
leucine-rich repeat 408..431 CDD:275380 6/23 (26%)
leucine-rich repeat 432..455 CDD:275380 8/22 (36%)
leucine-rich repeat 456..476 CDD:275380 7/21 (33%)
leucine-rich repeat 480..501 CDD:275380 7/22 (32%)
leucine-rich repeat 505..517 CDD:275378 3/11 (27%)
leucine-rich repeat 525..550 CDD:275380 9/79 (11%)
leucine-rich repeat 551..574 CDD:275380 7/22 (32%)
leucine-rich repeat 575..598 CDD:275380 7/22 (32%)
leucine-rich repeat 599..622 CDD:275380 6/22 (27%)
leucine-rich repeat 623..646 CDD:275380 4/22 (18%)
leucine-rich repeat 647..670 CDD:275380 7/22 (32%)
leucine-rich repeat 671..693 CDD:275380 8/21 (38%)
leucine-rich repeat 694..717 CDD:275380 5/22 (23%)
leucine-rich repeat 718..741 CDD:275380 3/22 (14%)
leucine-rich repeat 742..763 CDD:275380 6/25 (24%)
leucine-rich repeat 766..789 CDD:275380 8/23 (35%)
leucine-rich repeat 790..813 CDD:275380 4/27 (15%)
leucine-rich repeat 814..835 CDD:275380 6/20 (30%)
leucine-rich repeat 838..861 CDD:275380 8/22 (36%)
leucine-rich repeat 862..885 CDD:275380 0/22 (0%)
Tlr5XP_017177186.1 leucine-rich repeat 63..93 CDD:275380 6/29 (21%)
LRR <98..333 CDD:443914 53/235 (23%)
LRR_8 <99..146 CDD:404697 17/46 (37%)
leucine-rich repeat 112..135 CDD:275380 8/22 (36%)
leucine-rich repeat 136..161 CDD:275380 8/24 (33%)
leucine-rich repeat 162..186 CDD:275380 8/24 (33%)
leucine-rich repeat 187..242 CDD:275380 8/54 (15%)
leucine-rich repeat 243..304 CDD:275380 7/60 (12%)
leucine-rich repeat 305..328 CDD:275380 7/22 (32%)
LRR 322..>596 CDD:443914 89/363 (25%)
leucine-rich repeat 329..352 CDD:275380 7/22 (32%)
leucine-rich repeat 353..376 CDD:275380 11/46 (24%)
leucine-rich repeat 377..400 CDD:275380 7/22 (32%)
leucine-rich repeat 401..429 CDD:275380 13/54 (24%)
leucine-rich repeat 430..464 CDD:275380 9/42 (21%)
leucine-rich repeat 465..489 CDD:275380 8/23 (35%)
leucine-rich repeat 490..518 CDD:275380 4/27 (15%)
leucine-rich repeat 519..542 CDD:275380 6/22 (27%)
leucine-rich repeat 543..561 CDD:275380 6/17 (35%)
leucine-rich repeat 565..585 CDD:275380 7/19 (37%)
PCC 569..>647 CDD:188093 17/49 (35%)
TIR 708..858 CDD:396246
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.