DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment atk and tsku

DIOPT Version :10

Sequence 1:NP_649228.1 Gene:atk / 40266 FlyBaseID:FBgn0036995 Length:1535 Species:Drosophila melanogaster
Sequence 2:NP_001011330.1 Gene:tsku / 496792 XenbaseID:XB-GENE-493206 Length:350 Species:Xenopus tropicalis


Alignment Length:377 Identity:100/377 - (26%)
Similarity:153/377 - (40%) Gaps:116/377 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 LDLSHNGLNWIHLRALS--RLPNLVSLKLSHNQISDVGMVGRIVKDLEHLKKLRLDNNLITVIED 275
            ||||.||:..|:...||  ....|::|.||||||..:..  .....|.:|:.|.|.:||:..:.|
 Frog    64 LDLSANGIKRINESVLSGPGYTTLINLNLSHNQIVRISF--STFSKLRYLESLDLSHNLLETLPD 126

  Fly   276 GSFVDLPNLSELHLNDNRITELQYGAFLRTPQLK--TIYLQNNLIRRIHPESLLQASGSGVEAVH 338
            |||: ...|:||.|:.|::.|:..|||....|.:  ||.|.||.||.||         .|.|.  
 Frog   127 GSFL-YSRLTELDLSSNKLLEVGIGAFTLKSQGRSMTINLGNNNIRSIH---------RGAER-- 179

  Fly   339 MYNNEIGHVEALRALLDALPRLRYLDMSGNLLSELPYGALRGHGTLEQLHLNHNHLRLIERDALM 403
                             .:|.:..|.:|||.|..:|           .||               
 Frog   180 -----------------PVPNIHSLTLSGNDLLSVP-----------DLH--------------- 201

  Fly   404 AMPALRELRMRNNSLSSDLPLPFWNLPGLKGLDLAQNQFARVDSQLLAGLPSLRRLDLSE-NGLI 467
                                    .:| |:.|||.:|..|:::.:...||..|..|.||: ..|.
 Frog   202 ------------------------GIP-LRHLDLDRNPLAKIEKESFLGLEGLTHLSLSDLPNLR 241

  Fly   468 ELAPNSFRHNPLLETLNISSN-ELTKIHSSTLIHLERLFEVDASYNQLKSVIAGLPRIVERISLK 531
            |::|.||:..|.|..|::||| :|..:.|.....|:.|.|::.:|    |.:|.||:.:.     
 Frog   242 EVSPYSFKTLPSLLDLDLSSNPQLKSLSSDMFFGLDSLQELNLAY----SGVAALPKDIM----- 297

  Fly   532 GNQITSLPAAASKDLQLPNLRMLDLSQN-----RIEQLPRHGFQGAMELRVL 578
                          |.||:::.:...:|     .:::.|.|..:|.:...||
 Frog   298 --------------LNLPSMKSITWGENIRCSKTVKESPFHAQKGRVREEVL 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atkNP_649228.1 leucine-rich repeat 886..906 CDD:275380
PCC 891..>936 CDD:188093
leucine-rich repeat 69..89 CDD:275380
leucine-rich repeat 90..113 CDD:275380
LRR 93..530 CDD:443914 91/322 (28%)
leucine-rich repeat 115..138 CDD:275380
leucine-rich repeat 139..160 CDD:275380
leucine-rich repeat 161..184 CDD:275380
leucine-rich repeat 185..209 CDD:275380
leucine-rich repeat 210..233 CDD:275380 9/21 (43%)
leucine-rich repeat 234..259 CDD:275380 9/24 (38%)
leucine-rich repeat 260..283 CDD:275380 9/22 (41%)
leucine-rich repeat 284..307 CDD:275380 9/22 (41%)
leucine-rich repeat 308..359 CDD:275380 11/52 (21%)
leucine-rich repeat 334..348 CDD:275378 1/13 (8%)
PLN00113 359..>824 CDD:215061 51/227 (22%)
leucine-rich repeat 360..383 CDD:275380 6/22 (27%)
leucine-rich repeat 384..407 CDD:275380 2/22 (9%)
leucine-rich repeat 408..431 CDD:275380 0/22 (0%)
leucine-rich repeat 432..455 CDD:275380 8/22 (36%)
leucine-rich repeat 456..476 CDD:275380 9/20 (45%)
leucine-rich repeat 480..501 CDD:275380 7/21 (33%)
leucine-rich repeat 505..517 CDD:275378 2/11 (18%)
leucine-rich repeat 525..550 CDD:275380 2/24 (8%)
leucine-rich repeat 551..574 CDD:275380 4/27 (15%)
leucine-rich repeat 575..598 CDD:275380 2/4 (50%)
leucine-rich repeat 599..622 CDD:275380
leucine-rich repeat 623..646 CDD:275380
leucine-rich repeat 647..670 CDD:275380
leucine-rich repeat 671..693 CDD:275380
leucine-rich repeat 694..717 CDD:275380
leucine-rich repeat 718..741 CDD:275380
leucine-rich repeat 742..763 CDD:275380
leucine-rich repeat 766..789 CDD:275380
leucine-rich repeat 790..813 CDD:275380
leucine-rich repeat 814..835 CDD:275380
leucine-rich repeat 838..861 CDD:275380
leucine-rich repeat 862..885 CDD:275380
tskuNP_001011330.1 LRRNT 21..63 CDD:214470
LRR 1 60..81 8/16 (50%)
leucine-rich repeat 61..86 CDD:275380 9/21 (43%)
LRR <62..>236 CDD:443914 69/253 (27%)
LRR 2 86..107 8/22 (36%)
leucine-rich repeat 87..110 CDD:275380 9/24 (38%)
LRR 3 110..131 9/21 (43%)
leucine-rich repeat 111..133 CDD:275380 9/22 (41%)
LRR 4 133..154 9/20 (45%)
leucine-rich repeat 134..159 CDD:275380 10/24 (42%)
LRR 5 159..180 11/48 (23%)
leucine-rich repeat 160..183 CDD:275380 11/50 (22%)
LRR 6 183..203 8/69 (12%)
leucine-rich repeat 184..203 CDD:275380 8/68 (12%)
LRR 7 204..225 7/21 (33%)
LRR_8 205..286 CDD:404697 28/80 (35%)
leucine-rich repeat 205..228 CDD:275380 8/22 (36%)
LRR 8 228..250 9/21 (43%)
leucine-rich repeat 229..278 CDD:275380 18/48 (38%)
LRR 9 253..275 7/21 (33%)
LRR 10 278..299 7/43 (16%)
leucine-rich repeat 279..302 CDD:275380 9/45 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.