DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment atk and CG6749

DIOPT Version :10

Sequence 1:NP_649228.1 Gene:atk / 40266 FlyBaseID:FBgn0036995 Length:1535 Species:Drosophila melanogaster
Sequence 2:NP_648354.1 Gene:CG6749 / 39144 FlyBaseID:FBgn0036040 Length:552 Species:Drosophila melanogaster


Alignment Length:596 Identity:155/596 - (26%)
Similarity:248/596 - (41%) Gaps:141/596 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   428 NLPGLKGLDLAQNQFARVDSQLLAGLPSLRRLDLSENGLIELAPNSFRHNPLLETLNISSNELTK 492
            :|..|..|||.......|.:...:.||:||:|:||..||:::..|.|.....|:.::.|.|::..
  Fly    78 HLANLLDLDLTGAAPINVHTNGFSILPNLRQLNLSGCGLVDIRGNHFAPESALQRIDFSHNQMEL 142

  Fly   493 IHSSTLIHLERLFEVDASYNQLKSVIAGLPRIVERISLKGNQITSLPAAASKDLQLPNLRMLDLS 557
            :......:|.:|...:.|:|.||.                   ..||       .:|.|..|:|.
  Fly   143 LDRDFFGNLRKLIYANFSHNALKQ-------------------CDLP-------HMPLLNRLELG 181

  Fly   558 QNRIEQLPRHGFQGAMELRVLSLAQNELRQLKDTSFIGIQRLELLHLQENQLGEADERALLPLAE 622
            .||   |....|....:|:.|.|..|:|.||...:|.|:..|..|.|..|:|.........|||:
  Fly   182 HNR---LVNATFGVCPQLQELILNDNQLIQLDVNAFRGLHGLLELQLSGNRLSSIGLETFQPLAQ 243

  Fly   623 LRNLNLQSNKLEAITDNFFSNNS----RLEQLDLSRNLIRSISPTAFDTQRSLEYLDLSGNALLD 683
            ||.|||..|.|:|:..|.|....    .|:|||||.|.||.:....|.....|:.||:|.|::..
  Fly   244 LRKLNLSQNALDALRPNVFGAVQNFVLHLQQLDLSGNRIRLLFDNQFRVLARLQMLDVSRNSIAS 308

  Fly   684 IS----VGLGNLNNLRDIDLSYNQISRIQSDVIGGWRNVVEIRLSNNLIVELQQGTFRNLPKLQY 744
            :|    ||||   :||.:.|.|                        |.|:|::..||..|..|..
  Fly   309 LSPAHFVGLG---SLRKLYLQY------------------------NAILEIKPATFAALLNLDT 346

  Fly   745 LDLSSNEIRNVEPGALKGLDELQEFVLADNKLVELKDHVFEELPSLLASHFQYNKLRYISPESFH 809
            ||||.|           .|:.|:|.:...|           .||.:...:...|:::::.|.:|.
  Fly   347 LDLSYN-----------NLEFLEEQIFGGN-----------TLPRMRRLNLNGNRMKHLHPLAFS 389

  Fly   810 NANSLVFLNLSNNHFRNMENIGLRSMRNLEVLDLSTNGVKLVSTMPLKALNWLVELKMDNNQICR 874
            :...|.:|.|.:|..::::......||.|:.|.|..|.::.::...|::|:.:.|:.:|||    
  Fly   390 SLPFLEYLKLGHNELKSLDVRMFAPMRRLQKLHLGHNLLEEINLDVLESLSSVQEILVDNN---- 450

  Fly   875 IQGSPFETMPRLRVLSMRNNQLRSIKERTFRNVRGNIAILDVDGNPIDCNCEMQ---WLS----V 932
                      ||..|:..|....::|.            :.::|||..|.|.::   ||:    |
  Fly   451 ----------RLTFLAKVNVSFPNLKR------------VAIEGNPWQCPCFVKLQHWLATRDVV 493

  Fly   933 WLQETNFPYPGPKCQDGRLLRSARMERSLCVGADI-YGNERTDG-NQLPLLNEHGDVFQRDL--P 993
            :|::....|.|              ||.||:..:: |..:.... .:|.:|   || ||.:.  .
  Fly   494 YLRDNTGYYKG--------------ERPLCIVTNVDYCIQNLQAVRRLGIL---GD-FQGEQVEA 540

  Fly   994 DDFNDECEAGE 1004
            |.|:|:..|.:
  Fly   541 DAFDDDASAAQ 551

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atkNP_649228.1 leucine-rich repeat 886..906 CDD:275380 4/19 (21%)
PCC 891..>936 CDD:188093 11/51 (22%)
leucine-rich repeat 69..89 CDD:275380
leucine-rich repeat 90..113 CDD:275380
LRR 93..530 CDD:443914 26/101 (26%)
leucine-rich repeat 115..138 CDD:275380
leucine-rich repeat 139..160 CDD:275380
leucine-rich repeat 161..184 CDD:275380
leucine-rich repeat 185..209 CDD:275380
leucine-rich repeat 210..233 CDD:275380
leucine-rich repeat 234..259 CDD:275380
leucine-rich repeat 260..283 CDD:275380
leucine-rich repeat 284..307 CDD:275380
leucine-rich repeat 308..359 CDD:275380
leucine-rich repeat 334..348 CDD:275378
PLN00113 359..>824 CDD:215061 112/403 (28%)
leucine-rich repeat 360..383 CDD:275380
leucine-rich repeat 384..407 CDD:275380
leucine-rich repeat 408..431 CDD:275380 1/2 (50%)
leucine-rich repeat 432..455 CDD:275380 6/22 (27%)
leucine-rich repeat 456..476 CDD:275380 9/19 (47%)
leucine-rich repeat 480..501 CDD:275380 3/20 (15%)
leucine-rich repeat 505..517 CDD:275378 4/11 (36%)
leucine-rich repeat 525..550 CDD:275380 2/24 (8%)
leucine-rich repeat 551..574 CDD:275380 7/22 (32%)
leucine-rich repeat 575..598 CDD:275380 9/22 (41%)
leucine-rich repeat 599..622 CDD:275380 7/22 (32%)
leucine-rich repeat 623..646 CDD:275380 10/26 (38%)
leucine-rich repeat 647..670 CDD:275380 10/22 (45%)
leucine-rich repeat 671..693 CDD:275380 10/25 (40%)
leucine-rich repeat 694..717 CDD:275380 4/22 (18%)
leucine-rich repeat 718..741 CDD:275380 6/22 (27%)
leucine-rich repeat 742..763 CDD:275380 6/20 (30%)
leucine-rich repeat 766..789 CDD:275380 4/22 (18%)
leucine-rich repeat 790..813 CDD:275380 3/22 (14%)
leucine-rich repeat 814..835 CDD:275380 4/20 (20%)
leucine-rich repeat 838..861 CDD:275380 6/22 (27%)
leucine-rich repeat 862..885 CDD:275380 4/22 (18%)
CG6749NP_648354.1 LRR_8 104..164 CDD:404697 17/59 (29%)
leucine-rich repeat 106..129 CDD:275380 9/22 (41%)
leucine-rich repeat 130..153 CDD:275380 4/22 (18%)
leucine-rich repeat 154..195 CDD:275380 15/69 (22%)
leucine-rich repeat 196..219 CDD:275380 9/22 (41%)
LRR 199..>452 CDD:443914 87/315 (28%)
leucine-rich repeat 220..243 CDD:275380 7/22 (32%)
leucine-rich repeat 244..267 CDD:275380 10/22 (45%)
leucine-rich repeat 272..295 CDD:275380 10/22 (45%)
leucine-rich repeat 296..319 CDD:275380 10/25 (40%)
leucine-rich repeat 320..343 CDD:275380 10/46 (22%)
leucine-rich repeat 344..369 CDD:275380 11/46 (24%)
leucine-rich repeat 370..393 CDD:275380 3/22 (14%)
leucine-rich repeat 394..417 CDD:275380 5/22 (23%)
leucine-rich repeat 418..441 CDD:275380 6/22 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.