DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment atk and Lrg1

DIOPT Version :10

Sequence 1:NP_649228.1 Gene:atk / 40266 FlyBaseID:FBgn0036995 Length:1535 Species:Drosophila melanogaster
Sequence 2:XP_038939952.1 Gene:Lrg1 / 367455 RGDID:1359464 Length:342 Species:Rattus norvegicus


Alignment Length:338 Identity:100/338 - (29%)
Similarity:144/338 - (42%) Gaps:64/338 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   519 AGLPRIVERISLKGNQITSLPAAASKDLQ-LPNLRMLDLSQNRIEQLPRHGFQGAMELRVLSLAQ 582
            :.||.....:|::.:.:|.|||||   || .|.|:.|.||.||:::|..........||||.|.:
  Rat    57 SSLPADTVHLSVEFSSLTQLPAAA---LQGCPGLQELHLSSNRLQELSPGLLAPVPRLRVLDLTR 118

  Fly   583 NELRQLKDTSFIGIQRLELLHLQENQLGEADERALLPLAELRNLNLQSNKLEAITDNFFSNNSRL 647
            |.||.|....|.....|..|.|:||||.||..|.|..|..|..|:|..|:|.::.....:|...|
  Rat   119 NALRSLPPGLFRSSAALNTLVLRENQLQEASARWLQGLDALGYLDLAENRLRSLPARLLANLGAL 183

  Fly   648 EQLDLSRNLIRSISPTAFDTQRSLEYLDLSGNALLDISVG-LGNLNNLRDIDLSYNQISRIQSDV 711
            ..|||..||:.|:........|.|:.|.|.||.|..:..| |.....|..:.|:.||::.:.:| 
  Rat   184 HTLDLGHNLLESLPEGFLRGPRRLQRLHLEGNRLQRLEAGLLAPQPFLGVLFLNDNQLTAVAAD- 247

  Fly   712 IGGWRNVVEIRLSNNLIVELQQGTFRNLPKLQYLDLSSNEIRNVEPGALKGLD----ELQE-FVL 771
                                   :||.|.:|..||||:|.:.:..||....|.    ::|: |.:
  Rat   248 -----------------------SFRGLKQLDMLDLSNNSLSSTPPGLWAFLGRPTRDMQDGFDV 289

  Fly   772 ADNKLVELKDHVFEELPSLLASH----FQYNKLRYISPESFHNANSLVFLNLSNNHFRNMENIGL 832
            :.|..|..||.|  :|...||::    |..|......||:                        :
  Rat   290 SHNPWVCDKDLV--DLCRWLAANRHKMFSQNDTLCAGPEA------------------------V 328

  Fly   833 RSMRNLEVLDLST 845
            |..|.|:|.:|.|
  Rat   329 RGQRLLDVAELGT 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atkNP_649228.1 leucine-rich repeat 886..906 CDD:275380
PCC 891..>936 CDD:188093
leucine-rich repeat 69..89 CDD:275380
leucine-rich repeat 90..113 CDD:275380
LRR 93..530 CDD:443914 2/10 (20%)
leucine-rich repeat 115..138 CDD:275380
leucine-rich repeat 139..160 CDD:275380
leucine-rich repeat 161..184 CDD:275380
leucine-rich repeat 185..209 CDD:275380
leucine-rich repeat 210..233 CDD:275380
leucine-rich repeat 234..259 CDD:275380
leucine-rich repeat 260..283 CDD:275380
leucine-rich repeat 284..307 CDD:275380
leucine-rich repeat 308..359 CDD:275380
leucine-rich repeat 334..348 CDD:275378
PLN00113 359..>824 CDD:215061 94/315 (30%)
leucine-rich repeat 360..383 CDD:275380
leucine-rich repeat 384..407 CDD:275380
leucine-rich repeat 408..431 CDD:275380
leucine-rich repeat 432..455 CDD:275380
leucine-rich repeat 456..476 CDD:275380
leucine-rich repeat 480..501 CDD:275380
leucine-rich repeat 505..517 CDD:275378
leucine-rich repeat 525..550 CDD:275380 9/25 (36%)
leucine-rich repeat 551..574 CDD:275380 7/22 (32%)
leucine-rich repeat 575..598 CDD:275380 10/22 (45%)
leucine-rich repeat 599..622 CDD:275380 12/22 (55%)
leucine-rich repeat 623..646 CDD:275380 6/22 (27%)
leucine-rich repeat 647..670 CDD:275380 7/22 (32%)
leucine-rich repeat 671..693 CDD:275380 8/22 (36%)
leucine-rich repeat 694..717 CDD:275380 5/22 (23%)
leucine-rich repeat 718..741 CDD:275380 3/22 (14%)
leucine-rich repeat 742..763 CDD:275380 8/20 (40%)
leucine-rich repeat 766..789 CDD:275380 8/23 (35%)
leucine-rich repeat 790..813 CDD:275380 6/26 (23%)
leucine-rich repeat 814..835 CDD:275380 1/20 (5%)
leucine-rich repeat 838..861 CDD:275380 4/8 (50%)
leucine-rich repeat 862..885 CDD:275380
Lrg1XP_038939952.1 leucine-rich repeat 65..86 CDD:275380 9/23 (39%)
LRR <80..>267 CDD:443914 69/213 (32%)
leucine-rich repeat 87..110 CDD:275380 7/22 (32%)
leucine-rich repeat 111..134 CDD:275380 10/22 (45%)
leucine-rich repeat 135..158 CDD:275380 12/22 (55%)
leucine-rich repeat 159..182 CDD:275380 6/22 (27%)
leucine-rich repeat 183..206 CDD:275380 7/22 (32%)
leucine-rich repeat 207..230 CDD:275380 8/22 (36%)
leucine-rich repeat 231..254 CDD:275380 8/46 (17%)
leucine-rich repeat 255..278 CDD:275380 9/22 (41%)
PCC 259..>339 CDD:188093 25/105 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.