DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment atk and IGFALS

DIOPT Version :10

Sequence 1:NP_649228.1 Gene:atk / 40266 FlyBaseID:FBgn0036995 Length:1535 Species:Drosophila melanogaster
Sequence 2:NP_001139478.1 Gene:IGFALS / 3483 HGNCID:5468 Length:643 Species:Homo sapiens


Alignment Length:562 Identity:166/562 - (29%)
Similarity:246/562 - (43%) Gaps:76/562 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   411 LRMRNNSLSSDLPLPFWNLPGLKGLDLAQNQFARVDSQLLAGLPSLRRLDLSENGLIELAPNSFR 475
            |.:..|:|||..|..|.||..|..|:|...|...::.|.|.||.:|..|.|..|.|..||..:|.
Human   117 LWLDGNNLSSVPPAAFQNLSSLGFLNLQGGQLGSLEPQALLGLENLCHLHLERNQLRSLALGTFA 181

  Fly   476 HNPLLETLNISSNELTKIHSSTLIHLERLFEVDASYNQLKSVIAGLPRIVERISLKGNQITSLPA 540
            |.|.|.:|.:|:|.|:::.       :.|||             ||..:.: ::|..|.:..||.
Human   182 HTPALASLGLSNNRLSRLE-------DGLFE-------------GLGSLWD-LNLGWNSLAVLPD 225

  Fly   541 AASKDLQLPNLRMLDLSQNRIEQLPRHGFQGAMELRVLSLAQNELRQLKDTSFIGIQRLELLHLQ 605
            ||.:.  |.:||.|.|:.||:..|....|.|..|||.|.|::|.||.:|...|:.:.||:.|:|.
Human   226 AAFRG--LGSLRELVLAGNRLAYLQPALFSGLAELRELDLSRNALRAIKANVFVQLPRLQKLYLD 288

  Fly   606 ENQLGEADERALLPLAELRNLNLQSNKLEAITDNFFSNNSRLEQLDLSRNLIRSISPTAFDTQRS 670
            .|.:......|.|.|..||.|:|..|::..:.::.|.....|..|.||.|.|.|:.|..|.....
Human   289 RNLIAAVAPGAFLGLKALRWLDLSHNRVAGLLEDTFPGLLGLRVLRLSHNAIASLRPRTFKDLHF 353

  Fly   671 LEYLDLSGNALLDIS----VGLGNLNNLRDIDLSYNQISRIQSDVIGGWRNVVEIRLSNNLIVEL 731
            ||.|.|..|.:..::    .|||.|..|   .|.:||:..:::....|..||..:.||.|.:..|
Human   354 LEELQLGHNRIRQLAERSFEGLGQLEVL---TLDHNQLQEVKAGAFLGLTNVAVMNLSGNCLRNL 415

  Fly   732 QQGTFRNLPKLQYLDLSSNEIRNVEPGALKGLDELQEFVLADNKLVELKDHVFEELPSLLASHFQ 796
            .:..||.|.||..|.|..:.:..:.|....||..|:...|.||.||.:::.....|..||.....
Human   416 PEQVFRGLGKLHSLHLEGSCLGRIRPHTFTGLSGLRRLFLKDNGLVGIEEQSLWGLAELLELDLT 480

  Fly   797 YNKLRYISPESFHNANSLVFLNLSNNHFRNM--ENIGLRSMRNLEVLDLSTNGVKLVSTMPLKAL 859
            .|:|.::....|.....|.:|.||.|....:  :.:|                       ||:..
Human   481 SNQLTHLPHRLFQGLGKLEYLLLSRNRLAELPADALG-----------------------PLQRA 522

  Fly   860 NWLVELKMDNNQICRIQGSPFETMPRLRVLSMRNNQLRSIKERTFRNVRGNIAILDVDGNPIDCN 924
            .|   |.:.:|::..:..|....:.|||.||:|||.|     |||......:..|.::|||.||.
Human   523 FW---LDVSHNRLEALPNSLLAPLGRLRYLSLRNNSL-----RTFTPQPPGLERLWLEGNPWDCG 579

  Fly   925 CEMQWLSVWLQETNFPYPGPKCQDGRLLRSARMERSLCVGAD 966
            |.::.|      .:|....|..       ..|..:::|.|.|
Human   580 CPLKAL------RDFALQNPSA-------VPRFVQAICEGDD 608

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atkNP_649228.1 leucine-rich repeat 886..906 CDD:275380 11/19 (58%)
PCC 891..>936 CDD:188093 15/44 (34%)
leucine-rich repeat 69..89 CDD:275380
leucine-rich repeat 90..113 CDD:275380
LRR 93..530 CDD:443914 37/118 (31%)
leucine-rich repeat 115..138 CDD:275380
leucine-rich repeat 139..160 CDD:275380
leucine-rich repeat 161..184 CDD:275380
leucine-rich repeat 185..209 CDD:275380
leucine-rich repeat 210..233 CDD:275380
leucine-rich repeat 234..259 CDD:275380
leucine-rich repeat 260..283 CDD:275380
leucine-rich repeat 284..307 CDD:275380
leucine-rich repeat 308..359 CDD:275380
leucine-rich repeat 334..348 CDD:275378
PLN00113 359..>824 CDD:215061 133/416 (32%)
leucine-rich repeat 360..383 CDD:275380
leucine-rich repeat 384..407 CDD:275380
leucine-rich repeat 408..431 CDD:275380 9/19 (47%)
leucine-rich repeat 432..455 CDD:275380 8/22 (36%)
leucine-rich repeat 456..476 CDD:275380 8/19 (42%)
leucine-rich repeat 480..501 CDD:275380 5/20 (25%)
leucine-rich repeat 505..517 CDD:275378 2/11 (18%)
leucine-rich repeat 525..550 CDD:275380 7/24 (29%)
leucine-rich repeat 551..574 CDD:275380 9/22 (41%)
leucine-rich repeat 575..598 CDD:275380 9/22 (41%)
leucine-rich repeat 599..622 CDD:275380 7/22 (32%)
leucine-rich repeat 623..646 CDD:275380 6/22 (27%)
leucine-rich repeat 647..670 CDD:275380 9/22 (41%)
leucine-rich repeat 671..693 CDD:275380 9/25 (36%)
leucine-rich repeat 694..717 CDD:275380 5/22 (23%)
leucine-rich repeat 718..741 CDD:275380 8/22 (36%)
leucine-rich repeat 742..763 CDD:275380 4/20 (20%)
leucine-rich repeat 766..789 CDD:275380 7/22 (32%)
leucine-rich repeat 790..813 CDD:275380 5/22 (23%)
leucine-rich repeat 814..835 CDD:275380 6/22 (27%)
leucine-rich repeat 838..861 CDD:275380 2/22 (9%)
leucine-rich repeat 862..885 CDD:275380 3/22 (14%)
IGFALSNP_001139478.1 LRRNT 78..116 CDD:214470
leucine-rich repeat 95..113 CDD:275380
leucine-rich repeat 114..137 CDD:275380 9/19 (47%)
LRR 132..574 CDD:443914 147/498 (30%)
leucine-rich repeat 138..161 CDD:275380 8/22 (36%)
leucine-rich repeat 162..185 CDD:275380 9/22 (41%)
leucine-rich repeat 186..209 CDD:275380 10/42 (24%)
leucine-rich repeat 210..233 CDD:275380 7/25 (28%)
leucine-rich repeat 234..257 CDD:275380 9/22 (41%)
leucine-rich repeat 258..281 CDD:275380 9/22 (41%)
leucine-rich repeat 282..305 CDD:275380 7/22 (32%)
leucine-rich repeat 306..324 CDD:275380 5/17 (29%)
leucine-rich repeat 354..377 CDD:275380 7/22 (32%)
leucine-rich repeat 378..401 CDD:275380 6/25 (24%)
leucine-rich repeat 402..423 CDD:275380 7/20 (35%)
leucine-rich repeat 426..447 CDD:275380 4/20 (20%)
leucine-rich repeat 450..473 CDD:275380 7/22 (32%)
leucine-rich repeat 474..497 CDD:275380 5/22 (23%)
leucine-rich repeat 498..519 CDD:275380 6/43 (14%)
leucine-rich repeat 522..543 CDD:275380 4/23 (17%)
leucine-rich repeat 546..565 CDD:275380 11/23 (48%)
LRRCT 574..618 CDD:214507 12/48 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.