DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment atk and CG5096

DIOPT Version :9

Sequence 1:NP_001262113.1 Gene:atk / 40266 FlyBaseID:FBgn0036995 Length:1535 Species:Drosophila melanogaster
Sequence 2:NP_723576.1 Gene:CG5096 / 34410 FlyBaseID:FBgn0032235 Length:491 Species:Drosophila melanogaster


Alignment Length:454 Identity:114/454 - (25%)
Similarity:178/454 - (39%) Gaps:133/454 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   524 IVERISLKGNQITSLPAAASKDLQLPNLRMLDLSQNRIEQLPRHGFQGAMELRVLSLAQNEL--R 586
            :.:.|:|:.|.:||:|.....|::     .|.|:.|:|:.:....||...||..|.|:.|.|  :
  Fly    83 VFKTINLEHNNLTSVPILPKYDVE-----NLYLANNQIDSISVGAFQNLTELVTLDLSHNRLTSK 142

  Fly   587 QLKDTSFIG---IQRLELLHLQENQLGEADERALLPLAELRNLNLQSNKLEAITDNFFSNNSRLE 648
            .|....|.|   :|..|.|   ||               |:.|||..|.|.::..:.|.:...:|
  Fly   143 VLVPDVFKGPFTVQDFESL---EN---------------LKTLNLGYNDLHSLDADLFEHIPHIE 189

  Fly   649 QLDLSRN---LIRSISPTAFDTQRSLEYLDLSGNALLDISVGLGNLNNLRDIDLSYNQISRIQSD 710
            :|.|..|   :|..:|.||           :||            |.:|:.:|:||.:|..:...
  Fly   190 ELVLCSNSFHVIDQLSETA-----------ISG------------LQSLKILDVSYMEIDDLPDT 231

  Fly   711 VIGGWRNVVEIRLSNNLIVELQQGTFRNLPKLQYLDLSSNEIRNVEPGALKGLDELQEFVLADNK 775
            ::.|.|::.....:.||        |..|||                 |||....|...||.:|.
  Fly   232 ILHGPRDLEIFIAAGNL--------FNQLPK-----------------ALKYATNLTSLVLNENP 271

  Fly   776 LVEL-KDHVFEELPSL--LASHFQYNKLRYISPESFHNANSLVFLNLSNNHFRNMENIGLRSMRN 837
            :..| .|:||..|..|  |:..|. :||..|.|.:|....||..|.||:|...|        ..:
  Fly   272 IENLIGDNVFPPLTKLTHLSMTFM-SKLYKIGPGAFSELQSLTELILSDNKLLN--------EID 327

  Fly   838 LEVLDLSTNGVKLVSTMPLKALNWLVELKMDNNQICRIQGSPFETMPRLRVLSMRNNQLRSIKER 902
            .|.|..:..|.:.:...||:      ::.::|   |.:...|.|       |.:|.::|::    
  Fly   328 EEALSKNVTGGQYLDYPPLE------KVYLNN---CNVSTLPKE-------LLVRWDKLKA---- 372

  Fly   903 TFRNVRGNIAILDVDGNPIDCNCEMQWL-SVWLQETNFPYP---------GP-KCQDGRLLRSA 955
                       ||:..||.:|:....:| :|.:...|...|         || |..|..|||.|
  Fly   373 -----------LDLRFNPWNCDESNDFLINVLIDRINKTTPVLAKDVKCGGPNKLNDVTLLRVA 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atkNP_001262113.1 leucine-rich repeat 69..89 CDD:275380
leucine-rich repeat 90..113 CDD:275380
leucine-rich repeat 115..138 CDD:275380
leucine-rich repeat 139..160 CDD:275380
leucine-rich repeat 161..184 CDD:275380
LRR_8 183..244 CDD:290566
leucine-rich repeat 185..209 CDD:275380
LRR_4 209..247 CDD:289563
leucine-rich repeat 210..233 CDD:275380
leucine-rich repeat 234..259 CDD:275380
LRR_RI 250..492 CDD:238064
LRR_8 259..318 CDD:290566
leucine-rich repeat 260..283 CDD:275380
leucine-rich repeat 284..307 CDD:275380
leucine-rich repeat 308..359 CDD:275380
leucine-rich repeat 334..348 CDD:275378
LRR_8 358..418 CDD:290566
leucine-rich repeat 360..383 CDD:275380
leucine-rich repeat 384..407 CDD:275380
LRR_8 406..466 CDD:290566
leucine-rich repeat 408..431 CDD:275380
leucine-rich repeat 432..455 CDD:275380
LRR_RI 447..705 CDD:238064 49/188 (26%)
LRR_8 454..514 CDD:290566
leucine-rich repeat 456..476 CDD:275380
leucine-rich repeat 480..501 CDD:275380
leucine-rich repeat 505..517 CDD:275378
leucine-rich repeat 525..550 CDD:275380 7/24 (29%)
LRR_8 549..609 CDD:290566 20/64 (31%)
leucine-rich repeat 551..574 CDD:275380 6/22 (27%)
leucine-rich repeat 575..598 CDD:275380 8/27 (30%)
leucine-rich repeat 599..622 CDD:275380 4/22 (18%)
LRR_8 622..681 CDD:290566 17/61 (28%)
leucine-rich repeat 623..646 CDD:275380 7/22 (32%)
LRR_RI 647..896 CDD:238064 62/254 (24%)
leucine-rich repeat 647..670 CDD:275380 8/25 (32%)
leucine-rich repeat 671..693 CDD:275380 3/21 (14%)
leucine-rich repeat 694..717 CDD:275380 6/22 (27%)
LRR_8 716..776 CDD:290566 14/59 (24%)
leucine-rich repeat 718..741 CDD:275380 4/22 (18%)
leucine-rich repeat 742..763 CDD:275380 3/20 (15%)
LRR_8 765..824 CDD:290566 23/61 (38%)
leucine-rich repeat 766..789 CDD:275380 9/23 (39%)
leucine-rich repeat 790..813 CDD:275380 8/24 (33%)
leucine-rich repeat 814..835 CDD:275380 6/20 (30%)
leucine-rich repeat 838..861 CDD:275380 5/22 (23%)
LRR_8 862..921 CDD:290566 10/58 (17%)
leucine-rich repeat 862..885 CDD:275380 4/22 (18%)
leucine-rich repeat 886..906 CDD:275380 3/19 (16%)
TPKR_C2 919..>946 CDD:301599 9/37 (24%)
CG5096NP_723576.1 LRR_RI 69..378 CDD:238064 99/405 (24%)
leucine-rich repeat 85..104 CDD:275380 6/18 (33%)
LRR_8 105..174 CDD:290566 25/91 (27%)
leucine-rich repeat 105..128 CDD:275380 6/27 (22%)
leucine-rich repeat 129..163 CDD:275380 11/36 (31%)
LRR_8 163..222 CDD:290566 21/96 (22%)
leucine-rich repeat 164..187 CDD:275380 7/22 (32%)
leucine-rich repeat 188..214 CDD:275380 11/48 (23%)
leucine-rich repeat 215..238 CDD:275380 6/22 (27%)
leucine-rich repeat 239..261 CDD:275380 9/46 (20%)
LRR_8 260..322 CDD:290566 23/62 (37%)
leucine-rich repeat 262..286 CDD:275380 9/23 (39%)
leucine-rich repeat 287..311 CDD:275380 8/24 (33%)
leucine-rich repeat 346..369 CDD:275380 7/38 (18%)
leucine-rich repeat 370..388 CDD:275380 6/32 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45617
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.