DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment atk and Podnl1

DIOPT Version :10

Sequence 1:NP_649228.1 Gene:atk / 40266 FlyBaseID:FBgn0036995 Length:1535 Species:Drosophila melanogaster
Sequence 2:NP_001387869.1 Gene:Podnl1 / 288907 RGDID:1307753 Length:582 Species:Rattus norvegicus


Alignment Length:588 Identity:163/588 - (27%)
Similarity:254/588 - (43%) Gaps:110/588 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   350 LRALLDALPR-LRYLDMSGNLLSELPYGALRGHGTLEQLHLNHNHLRLIERDALMAMPALRELRM 413
            ||...|.:.| .|:|.:..|.|.||||                        :.|..:..||.|.:
  Rat    72 LRVFPDNITRAARHLSLQKNQLQELPY------------------------NELSRLSGLRTLDL 112

  Fly   414 RNNSLSSDLPLP---FWNLPGLKGLDLAQNQFARVDSQLLAGLPSLRRLDLSENGLIELAPNSFR 475
            .:|.:||: .||   |.:|..|:...:|.|:.: |..|.|.  .|||..||:.|.::|:.|.:|.
  Rat   113 HSNLISSE-GLPDEAFESLTQLENFYVAHNKLS-VAPQFLP--RSLRVADLAANEVVEIFPLTFG 173

  Fly   476 HNPLLETLNISSNEL--TKIHSSTLIHLERLFEVDASYNQLKSVIAGLPRIVERISLKGNQITSL 538
            ..|.|.::.:.:|.|  |.:..:|....|.:..:..|.|||:.:...||..:||:.|:.|.|:.:
  Rat   174 EKPALRSVYLHNNRLRNTGLPPNTFHGSEAITTLSLSSNQLRYLPPSLPASLERLHLQNNLISKV 238

  Fly   539 PAAASKDLQLPNLRMLDLSQNRIEQLPRHGFQGAMELRVLSLAQNELRQLKDTSFIGIQRLELLH 603
            |                              :||:.|      |.:||:              |:
  Rat   239 P------------------------------RGALSL------QTQLRE--------------LY 253

  Fly   604 LQENQLGEA--DERALLPLAELRNLNLQSNKLEAITDNFFSNNSRLEQLDLSRNLIRSISPTAFD 666
            ||.|||.::  |......|:.|..|:|..|:|..:.:....|   |..|.|.||.||.:......
  Rat   254 LQHNQLTDSGLDATTFSKLSSLEYLDLSHNQLATVPEGLPGN---LTILHLGRNCIRHVEAIRLH 315

  Fly   667 TQRSLEYLDLSGNALLDISVGLGNLNNLR---DIDLSYNQISRIQSDVIGGWRNVVEIRLSNNLI 728
            ..:.|.||.|..|.|...::..|.|..||   .:.|..|::.|:...:.   |::..:.:.:|.:
  Rat   316 KAKGLRYLLLQHNKLEASALPAGTLRPLRALHTLHLYGNRLERVPPALP---RHLQALVMPHNRV 377

  Fly   729 VELQQGTFRNLPKLQYLDLSSNEI--RNVEPGALKGLDELQEFVLADNKLVELKDHVFEELPSLL 791
            ..|......:...|..|:|:.|.:  .:|.|||.:.|..|:...||.|:|..|.    |.||:.|
  Rat   378 AALGARDLVSARALTELNLAYNRLASAHVHPGAFRRLRALRSLDLAGNQLSRLP----EGLPASL 438

  Fly   792 AS-HFQYNKLRYISPESFHNANSLVFLNLSNNHFR--NMENIGLRSMRNLEVLDLSTNGVKLVST 853
            .| ..|.|:||.:.||.....|.|..|||::|..|  ::|......::.|:|||||.|.:..|  
  Rat   439 RSLRLQRNQLRTLEPEQLAGLNKLRELNLAHNRLRVGDIEPGAWHELQALQVLDLSHNELSFV-- 501

  Fly   854 MPLKALNWLVELKMDNNQICRIQGSPFETMPRLRVLSMRNNQLR--SIKERTFRNVRGNIAILDV 916
             |......|.||.:..|:|..:....|.:.|.||.||:|.|:|.  ||....||.: .::.::|.
  Rat   502 -PPDLPEALEELYLQANRISHVGPEAFLSTPHLRALSLRANRLHMTSIAAEAFRGL-AHLRVVDT 564

  Fly   917 DGN 919
            ..|
  Rat   565 AEN 567

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atkNP_649228.1 leucine-rich repeat 886..906 CDD:275380 10/21 (48%)
PCC 891..>936 CDD:188093 9/31 (29%)
leucine-rich repeat 69..89 CDD:275380
leucine-rich repeat 90..113 CDD:275380
LRR 93..530 CDD:443914 53/185 (29%)
leucine-rich repeat 115..138 CDD:275380
leucine-rich repeat 139..160 CDD:275380
leucine-rich repeat 161..184 CDD:275380
leucine-rich repeat 185..209 CDD:275380
leucine-rich repeat 210..233 CDD:275380
leucine-rich repeat 234..259 CDD:275380
leucine-rich repeat 260..283 CDD:275380
leucine-rich repeat 284..307 CDD:275380
leucine-rich repeat 308..359 CDD:275380 3/8 (38%)
leucine-rich repeat 334..348 CDD:275378
PLN00113 359..>824 CDD:215061 129/478 (27%)
leucine-rich repeat 360..383 CDD:275380 8/22 (36%)
leucine-rich repeat 384..407 CDD:275380 1/22 (5%)
leucine-rich repeat 408..431 CDD:275380 10/25 (40%)
leucine-rich repeat 432..455 CDD:275380 6/22 (27%)
leucine-rich repeat 456..476 CDD:275380 8/19 (42%)
leucine-rich repeat 480..501 CDD:275380 5/22 (23%)
leucine-rich repeat 505..517 CDD:275378 4/11 (36%)
leucine-rich repeat 525..550 CDD:275380 6/24 (25%)
leucine-rich repeat 551..574 CDD:275380 2/22 (9%)
leucine-rich repeat 575..598 CDD:275380 4/22 (18%)
leucine-rich repeat 599..622 CDD:275380 8/24 (33%)
leucine-rich repeat 623..646 CDD:275380 6/22 (27%)
leucine-rich repeat 647..670 CDD:275380 7/22 (32%)
leucine-rich repeat 671..693 CDD:275380 8/21 (38%)
leucine-rich repeat 694..717 CDD:275380 5/25 (20%)
leucine-rich repeat 718..741 CDD:275380 2/22 (9%)
leucine-rich repeat 742..763 CDD:275380 8/22 (36%)
leucine-rich repeat 766..789 CDD:275380 8/22 (36%)
leucine-rich repeat 790..813 CDD:275380 8/23 (35%)
leucine-rich repeat 814..835 CDD:275380 7/22 (32%)
leucine-rich repeat 838..861 CDD:275380 9/22 (41%)
leucine-rich repeat 862..885 CDD:275380 6/22 (27%)
Podnl1NP_001387869.1 leucine-rich repeat 64..82 CDD:275380 3/9 (33%)
leucine-rich repeat 83..106 CDD:275380 9/46 (20%)
PLN00113 86..>521 CDD:215061 143/525 (27%)
leucine-rich repeat 107..132 CDD:275380 10/25 (40%)
leucine-rich repeat 133..177 CDD:275380 15/46 (33%)
leucine-rich repeat 178..203 CDD:275380 5/24 (21%)
leucine-rich repeat 204..224 CDD:275380 6/19 (32%)
leucine-rich repeat 225..248 CDD:275380 10/58 (17%)
leucine-rich repeat 249..274 CDD:275380 10/38 (26%)
leucine-rich repeat 275..319 CDD:275380 13/46 (28%)
leucine-rich repeat 298..317 CDD:275380 6/18 (33%)
leucine-rich repeat 320..345 CDD:275380 9/24 (38%)
leucine-rich repeat 346..390 CDD:275380 6/46 (13%)
leucine-rich repeat 391..416 CDD:275380 9/24 (38%)
leucine-rich repeat 417..440 CDD:275380 10/26 (38%)
leucine-rich repeat 441..461 CDD:275380 6/19 (32%)
leucine-rich repeat 462..487 CDD:275380 7/24 (29%)
LRR_8 509..563 CDD:404697 18/54 (33%)
leucine-rich repeat 509..532 CDD:275380 6/22 (27%)
leucine-rich repeat 533..556 CDD:275380 11/22 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.