DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment atk and lron-11

DIOPT Version :10

Sequence 1:NP_649228.1 Gene:atk / 40266 FlyBaseID:FBgn0036995 Length:1535 Species:Drosophila melanogaster
Sequence 2:NP_491035.1 Gene:lron-11 / 171837 WormBaseID:WBGene00022129 Length:542 Species:Caenorhabditis elegans


Alignment Length:464 Identity:125/464 - (26%)
Similarity:212/464 - (45%) Gaps:80/464 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   472 NSFRHNPLL-----ETLNISSNELTKIHSSTLIHLERLFEVDASYNQLKSVIAGLPRIVERISLK 531
            :|.|..|:|     ..|::|:|.::::.:..|          :.|..|           |::.|.
 Worm    35 SSLRSIPILLDPRTTVLDLSNNRISRLSADEL----------SLYPNL-----------EQLILH 78

  Fly   532 GNQITSLPAAASKDLQLPNLRMLDLSQNRIEQLPRHGFQGAMELRVLSLAQNELRQLKDTSFIGI 596
            .|.||.|.|....  .||:||:||||.|.:..||...|.....|:.|.::.|:: ||....|.|:
 Worm    79 NNSITHLSADVFS--TLPSLRVLDLSSNSLLSLPNEVFSKLKNLKTLIISSNDV-QLGPECFAGL 140

  Fly   597 QRLELLHLQENQLGEADERALLPLAELRNLNLQSNKLEAITDNFFSNNSRLEQLDLSRNLIRSIS 661
            .:|:.|.:.:|:|.......|.||:.||||:|.:|||.::..:..:|...||.|.|.:||:.|:.
 Worm   141 SQLQTLSIADNRLSFLPPSVLKPLSGLRNLDLSANKLLSMPASVMNNLGGLETLKLKQNLLSSLE 205

  Fly   662 PTAFDTQRSLEYLDLSGNALLDISVG-LGNLNNLRDIDLSYNQISRIQSDVIGGWR--NVVEIRL 723
            ...|.:|:.|::||:|.|.:.||..| |..|..|..::|:.||:.|:..:.   |.  .:..:.|
 Worm   206 TGMFLSQKELKHLDVSENLIGDIEEGALYGLEKLETLNLTNNQLVRLPGNT---WSLPALKTLDL 267

  Fly   724 SNNLIVELQQGTFRNLPKLQYLDLS-SNEIRNVEPGALKGLDELQEFVLADNKLVELKDHVFEEL 787
            |:||.|.|:..:|..||.||||::| |..::.::......|..|....::.:.|..:....|..:
 Worm   268 SSNLFVSLETASFDGLPALQYLNISHSRNLKTIQMATFVQLSSLHWLSISSSALTHIHPSAFNPI 332

  Fly   788 PSLLASHFQYNKLRYISPESFHNANSLVFLNLSNNHFRN----------MENIGLRSMRNLEVLD 842
            |.|.......|:|||::|      ..|.:.|:.|.|..|          :.|:..|.       |
 Worm   333 PPLSHLDLSNNELRYVAP------GMLQWPNIRNLHLANNDW
HCSCDLRVSNLNPRD-------D 384

  Fly   843 LSTNGVKLVSTMPLKALNWLVELKMDNNQICRIQGS---PFETMPRLRVLSM-------RNNQLR 897
            ...:|.:.::..|:..|:           .|.|.|.   ||..:..:.:|::       :.::..
 Worm   385 AKCSGPENLAGAPINELS-----------SCSILGGLLIPFLLVLFILLLALVILALACKKSKPV 438

  Fly   898 SIKERTFRN 906
            |:|.|.|.|
 Worm   439 SLKNRAFYN 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atkNP_649228.1 leucine-rich repeat 886..906 CDD:275380 5/26 (19%)
PCC 891..>936 CDD:188093 5/23 (22%)
leucine-rich repeat 69..89 CDD:275380
leucine-rich repeat 90..113 CDD:275380
LRR 93..530 CDD:443914 11/62 (18%)
leucine-rich repeat 115..138 CDD:275380
leucine-rich repeat 139..160 CDD:275380
leucine-rich repeat 161..184 CDD:275380
leucine-rich repeat 185..209 CDD:275380
leucine-rich repeat 210..233 CDD:275380
leucine-rich repeat 234..259 CDD:275380
leucine-rich repeat 260..283 CDD:275380
leucine-rich repeat 284..307 CDD:275380
leucine-rich repeat 308..359 CDD:275380
leucine-rich repeat 334..348 CDD:275378
PLN00113 359..>824 CDD:215061 106/360 (29%)
leucine-rich repeat 360..383 CDD:275380
leucine-rich repeat 384..407 CDD:275380
leucine-rich repeat 408..431 CDD:275380
leucine-rich repeat 432..455 CDD:275380
leucine-rich repeat 456..476 CDD:275380 1/3 (33%)
leucine-rich repeat 480..501 CDD:275380 5/25 (20%)
leucine-rich repeat 505..517 CDD:275378 2/11 (18%)
leucine-rich repeat 525..550 CDD:275380 8/24 (33%)
leucine-rich repeat 551..574 CDD:275380 10/22 (45%)
leucine-rich repeat 575..598 CDD:275380 7/22 (32%)
leucine-rich repeat 599..622 CDD:275380 7/22 (32%)
leucine-rich repeat 623..646 CDD:275380 9/22 (41%)
leucine-rich repeat 647..670 CDD:275380 9/22 (41%)
leucine-rich repeat 671..693 CDD:275380 10/22 (45%)
leucine-rich repeat 694..717 CDD:275380 6/24 (25%)
leucine-rich repeat 718..741 CDD:275380 8/22 (36%)
leucine-rich repeat 742..763 CDD:275380 6/21 (29%)
leucine-rich repeat 766..789 CDD:275380 3/22 (14%)
leucine-rich repeat 790..813 CDD:275380 6/22 (27%)
leucine-rich repeat 814..835 CDD:275380 7/30 (23%)
leucine-rich repeat 838..861 CDD:275380 4/22 (18%)
leucine-rich repeat 862..885 CDD:275380 5/25 (20%)
lron-11NP_491035.1 LRR 33..368 CDD:443914 108/365 (30%)
leucine-rich repeat 48..71 CDD:275380 5/32 (16%)
leucine-rich repeat 72..95 CDD:275380 9/35 (26%)
leucine-rich repeat 96..119 CDD:275380 10/22 (45%)
leucine-rich repeat 120..142 CDD:275380 7/22 (32%)
leucine-rich repeat 143..166 CDD:275380 7/22 (32%)
leucine-rich repeat 167..190 CDD:275380 9/22 (41%)
leucine-rich repeat 191..214 CDD:275380 9/22 (41%)
leucine-rich repeat 215..238 CDD:275380 10/22 (45%)
leucine-rich repeat 239..261 CDD:275380 6/24 (25%)
leucine-rich repeat 262..283 CDD:275380 7/20 (35%)
leucine-rich repeat 286..310 CDD:275380 7/23 (30%)
leucine-rich repeat 311..334 CDD:275380 3/22 (14%)
leucine-rich repeat 335..357 CDD:275380 7/27 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.