DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hpd and hpd-like.2

DIOPT Version :9

Sequence 1:NP_730536.1 Gene:Hpd / 40263 FlyBaseID:FBgn0036992 Length:380 Species:Drosophila melanogaster
Sequence 2:NP_001025588.1 Gene:hpd-like.2 / 594976 XenbaseID:XB-GENE-986330 Length:394 Species:Xenopus tropicalis


Alignment Length:383 Identity:245/383 - (63%)
Similarity:300/383 - (78%) Gaps:4/383 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTSYTDKGTKPEAGKFLSFDHLTFYVGNAKQAASYYTTRLGFEPLGYQGLETGERRFAKHAVRQN 65
            ||||||||.|...|:||||.||||:|||||||||:|..:.||||..|:|||||.|....||::|:
 Frog     1 MTSYTDKGEKHARGRFLSFHHLTFWVGNAKQAASFYCDKFGFEPCAYKGLETGSRDVVSHAIKQD 65

  Fly    66 KIVFVFVSAYTPDDEEHGLHLMRHGDGVKDVAFEVEDLNAIFTLAVSRGAEVVRDIWEESDDQGF 130
            ||:|||.|...|.::|.|.|:::||||||||||:|||.:.:|..|...||.|||:.|.|.|:.|.
 Frog    66 KIIFVFQSPLNPGNQEMGQHMIKHGDGVKDVAFQVEDCDFLFQKAKDHGAVVVREPWIEEDEGGK 130

  Fly   131 VRFATIKTYGDTTHTFVERNG-YAGDFLPGFQRSP--KDVLLNGLPSTKLNFIDHVVGNQPDLQM 192
            |::|.::||||||||.:|..| |.|.||||: :.|  :|.||..|||..|:||||:||||||.:|
 Frog   131 VKYAVLQTYGDTTHTLLEYLGPYRGVFLPGY-KEPLFRDPLLPTLPSGCLSFIDHIVGNQPDNEM 194

  Fly   193 ESVASWYERILQFHRFWSVDDSQIHTEYSALRSIVMANYEETVKMPINEPANGKKKSQIQEYVEY 257
            ..:..||::.|.|||||||||.|||||||:|||||:.|||||:||||||||.|||||||||||:|
 Frog   195 VPIVEWYQKCLLFHRFWSVDDKQIHTEYSSLRSIVVTNYEETIKMPINEPAAGKKKSQIQEYVDY 259

  Fly   258 YGGGGVQHIALNTDDIIEAVSNLKARGTEFLTIPSSYYEILQEQLSHSRTKIKEDMEVLKKLNIL 322
            ||..|||||||||.:||:||.|||:||.|||:.|.:|||.|:::|..::..:|||:.||::|.||
 Frog   260 YGSAGVQHIALNTSNIIKAVKNLKSRGIEFLSAPDTYYEELRKKLKTAKITVKEDLNVLQELKIL 324

  Fly   323 IDFDENGYLLQIFTKNCQDRPTLFLEVIQRYNHNGFGAGNFKSLFTAIEIEQAKRGNL 380
            :|:|:.|||||||||..||||||||||||||||.|||||||||||.|||.:|..||||
 Frog   325 VDYDDKGYLLQIFTKPMQDRPTLFLEVIQRYNHFGFGAGNFKSLFEAIETDQDARGNL 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HpdNP_730536.1 4HPPD 17..380 CDD:273528 232/365 (64%)
hpd-like.2NP_001025588.1 4HPPD 17..382 CDD:273528 232/365 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 235 1.000 Domainoid score I2317
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 518 1.000 Inparanoid score I1255
OMA 1 1.010 - - QHG63570
OrthoDB 1 1.010 - - D1087836at2759
OrthoFinder 1 1.000 - - FOG0004104
OrthoInspector 1 1.000 - - otm47514
Panther 1 1.100 - - LDO PTHR11959
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2577
SonicParanoid 1 1.000 - - X2845
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.110

Return to query results.
Submit another query.