DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL15 and RPL28

DIOPT Version :9

Sequence 1:NP_524185.1 Gene:mRpL15 / 40261 FlyBaseID:FBgn0036990 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_011412.1 Gene:RPL28 / 852775 SGDID:S000003071 Length:149 Species:Saccharomyces cerevisiae


Alignment Length:171 Identity:34/171 - (19%)
Similarity:55/171 - (32%) Gaps:52/171 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 PNPNSKQNDKRGRAQHGGDKHG-----AGNKGSGQRQNFMRLGYETGNQPFYLRFPYEPYYKG-- 85
            |:..:|....||....|..:.|     .|.:|....|:..|:..:          .|.|.|.|  
Yeast     2 PSRFTKTRKHRGHVSAGKGRIGKHRKHPGGRGMAGGQHHHRINMD----------KYHPGYFGKV 56

  Fly    86 -----HHLKRQY--PPISLLQLQVLIDTNRIDISQPIDISTLCNSGLLKLKPAEME--------- 134
                 |..:..:  |.::|.:|..||..::.|               ..||.|..|         
Yeast    57 GMRYFHKQQAHFWKPVLNLDKLWTLIPEDKRD---------------QYLKSASKETAPVIDTLA 106

  Fly   135 --YGFQLTDDGLDNFQAKINIEVQHASEAVIAAIEKNGGVI 173
              ||..|....:.|  ..:.::.:..|:.....|...|||:
Yeast   107 AGYGKILGKGRIPN--VPVIVKARFVSKLAEEKIRAAGGVV 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL15NP_524185.1 Ribosomal_L18e 45..175 CDD:279201 29/154 (19%)
RPL28NP_011412.1 PTZ00160 1..149 CDD:185489 34/171 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.