DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL15 and AT5G64670

DIOPT Version :9

Sequence 1:NP_524185.1 Gene:mRpL15 / 40261 FlyBaseID:FBgn0036990 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_201272.1 Gene:AT5G64670 / 836588 AraportID:AT5G64670 Length:281 Species:Arabidopsis thaliana


Alignment Length:212 Identity:60/212 - (28%)
Similarity:98/212 - (46%) Gaps:13/212 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TSDKALKL--LRTLPRVQIGNLRPNPNSKQNDKRGRAQHGGDKHGAGNKGSGQR-QNFMRLGYET 68
            ::.:||..  :|....:.:.:||.|...|...::||....|....||....||: :..|:.|:|.
plant    48 STSRALSFQGIRAYSLLSLNDLRDNVPRKLKTRKGRGIGSGKGKTAGRGHKGQKARGTMKFGFEG 112

  Fly    69 GNQPFYLRFPYEPYYKGHHLKRQYPPISLLQLQVLIDTNRIDISQPIDISTLCNSGLLKLKPAEM 133
            |..|...|.|...:  .:..|..:.|:.|.::..||:..:||..:.|.:.||.:.|.:   ..::
plant   113 GQTPLRRRLPKRGF--KNKFKLHFQPVGLGKIAKLINAGKIDSHELITMKTLKDVGAI---GKQI 172

  Fly   134 EYGFQLTDDGLDNFQAKINIEVQHASEAVIAAIEKNGGVIRTAYYDPRSLHMLANPKKWFE-KGV 197
            |.|.:|...|.|:.:..::.||...:......:|..||.:|..||:...|..|..| :||| ||.
plant   173 EDGVRLMGRGADDIKWPLHFEVSRVTVRAKEVVEAAGGSVRRVYYNKLGLRALLKP-EWFEKKGR 236

  Fly   198 PIPSRMLPP---QDAVD 211
            .:|....||   ||.||
plant   237 LLPKAARPPPKQQDKVD 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL15NP_524185.1 Ribosomal_L18e 45..175 CDD:279201 33/130 (25%)
AT5G64670NP_201272.1 rplO 66..212 CDD:235523 39/150 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0200
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 78 1.000 Inparanoid score I2394
OMA 1 1.010 - - QHG55287
OrthoDB 1 1.010 - - D930708at2759
OrthoFinder 1 1.000 - - FOG0003453
OrthoInspector 1 1.000 - - oto3498
orthoMCL 1 0.900 - - OOG6_100988
Panther 1 1.100 - - LDO PTHR12934
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.880

Return to query results.
Submit another query.