DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL15 and RPL15

DIOPT Version :9

Sequence 1:NP_524185.1 Gene:mRpL15 / 40261 FlyBaseID:FBgn0036990 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_189221.1 Gene:RPL15 / 822189 AraportID:AT3G25920 Length:277 Species:Arabidopsis thaliana


Alignment Length:244 Identity:56/244 - (22%)
Similarity:81/244 - (33%) Gaps:66/244 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 HLRETSDK--------------ALKLLRTL----------------------------PRVQIGN 25
            ||..||.|              :|||.:||                            .|.::.|
plant    21 HLSSTSFKGNVSVLGANPSQILSLKLNQTLKTRNQQQFARPLVVVSQTAATSSAVVAPERFRLDN 85

  Fly    26 LRPNPNSKQNDKR-GRAQHGGD--KHGAGNKGSGQRQ--NFMRLGYETGNQPFYLRFPYEPYYKG 85
            |.|.|.|::..|| ||....|.  ..|.|.:|...|.  ..|| |:|.|....|.|.|......|
plant    86 LGPQPGSRKKQKRKGRGISAGQGASCGFGMRGQKSRSGPGIMR-GFEGGQTALYRRLPKLRGIAG 149

  Fly    86 HHLK--RQYPPISLLQLQVLIDTNRIDISQPIDISTLCNSGLLKLKPAEMEYGFQLTDDGLDNFQ 148
            ....  .:|.|:::..    |:|........:.:.||...||  :.|:..|....|...|.....
plant   150 GMRSGLPKYLPVNIKD----IETAGFQEGDEVSLETLKQKGL--INPSGRERKLPLKILGTGELS 208

  Fly   149 AKINIEVQHASEAVIAAIEKNGGVIRTAYYDPRSLHMLANPKKWFEKGV 197
            .|:..:.:..|......:|.:|          .:|.:|...|||.:..|
plant   209 MKLTFKARAFSTQAKEKLEASG----------CTLTVLPGRKKWVKPSV 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL15NP_524185.1 Ribosomal_L18e 45..175 CDD:279201 30/135 (22%)
RPL15NP_189221.1 rplO 82..236 CDD:235523 40/170 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D930708at2759
OrthoFinder 1 1.000 - - FOG0003453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100988
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.