DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL15 and mrpl15

DIOPT Version :9

Sequence 1:NP_524185.1 Gene:mRpL15 / 40261 FlyBaseID:FBgn0036990 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_001003435.1 Gene:mrpl15 / 445041 ZFINID:ZDB-GENE-040801-168 Length:296 Species:Danio rerio


Alignment Length:284 Identity:143/284 - (50%)
Similarity:197/284 - (69%) Gaps:1/284 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAHLRETSDKALKLLRTLPRVQIGNLRPNPNSKQNDK-RGRAQHGGDKHGAGNKGSGQRQNFMRL 64
            |:.:::...|.:::::.|||:.:.||||||.:|..:| |||..|||::.|.|:||..||.|..||
Zfish     1 MSLIKKPGGKTIEVVKNLPRITLANLRPNPGAKTLEKRRGRGMHGGNRSGWGHKGERQRCNRPRL 65

  Fly    65 GYETGNQPFYLRFPYEPYYKGHHLKRQYPPISLLQLQVLIDTNRIDISQPIDISTLCNSGLLKLK 129
            |:|.|..||||..|...|...|..:.||||:||.:||.|||..|||.|||||::.|.|...::::
Zfish    66 GFEGGQTPFYLVIPKYGYNANHSRQPQYPPLSLRRLQYLIDLGRIDPSQPIDLTQLVNGRGVEIQ 130

  Fly   130 PAEMEYGFQLTDDGLDNFQAKINIEVQHASEAVIAAIEKNGGVIRTAYYDPRSLHMLANPKKWFE 194
            |.:.:||.||.|:|.|.|.||:|:|||.|||..|||:|:|||||.|:|||||||.:|..|..:|.
Zfish   131 PQKRDYGVQLVDEGADIFCAKVNLEVQAASEKAIAAVERNGGVITTSYYDPRSLQILIKPVPFFM 195

  Fly   195 KGVPIPSRMLPPQDAVDYYTDPKNRGYLANPEAISQDRLVLAQKYGYQLPKIEEDSAYEMLTTAK 259
            .|.|||.|:.|.:|.:.||||..||||||:|:.|...|:.||:||||.:|.|.:|:.:|||...|
Zfish   196 PGEPIPKRLFPGEDLLPYYTDANNRGYLADPDKIQTARMDLAKKYGYSIPDISKDTLFEMLVQRK 260

  Fly   260 DPRQVFYGLEPGWLINIVDKTIIK 283
            :||.:|:||.|||::|:.||.|:|
Zfish   261 NPRHIFFGLSPGWVVNMADKKILK 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL15NP_524185.1 Ribosomal_L18e 45..175 CDD:279201 68/129 (53%)
mrpl15NP_001003435.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 25..59 18/33 (55%)
Ribosomal_L18e 46..176 CDD:279201 68/129 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596501
Domainoid 1 1.000 134 1.000 Domainoid score I4982
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H32210
Inparanoid 1 1.050 300 1.000 Inparanoid score I2666
OMA 1 1.010 - - QHG55287
OrthoDB 1 1.010 - - D423799at33208
OrthoFinder 1 1.000 - - FOG0003453
OrthoInspector 1 1.000 - - oto40897
orthoMCL 1 0.900 - - OOG6_100988
Panther 1 1.100 - - LDO PTHR12934
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1154
SonicParanoid 1 1.000 - - X5091
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1514.940

Return to query results.
Submit another query.