DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL15 and MRPL15

DIOPT Version :9

Sequence 1:NP_524185.1 Gene:mRpL15 / 40261 FlyBaseID:FBgn0036990 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_054894.1 Gene:MRPL15 / 29088 HGNCID:14054 Length:296 Species:Homo sapiens


Alignment Length:274 Identity:149/274 - (54%)
Similarity:195/274 - (71%) Gaps:0/274 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KALKLLRTLPRVQIGNLRPNPNSKQNDKRGRAQHGGDKHGAGNKGSGQRQNFMRLGYETGNQPFY 74
            :||.|||.||||.:.||:|||.||:.::|.|.:..|.|.|.|:||..||....|||:|.|..|||
Human    11 RALDLLRGLPRVSLANLKPNPGSKKPERRPRGRRRGRKCGRGHKGERQRGTRPRLGFEGGQTPFY 75

  Fly    75 LRFPYEPYYKGHHLKRQYPPISLLQLQVLIDTNRIDISQPIDISTLCNSGLLKLKPAEMEYGFQL 139
            :|.|...:.:||..:|||.|:||.:||.|||..|:|.|||||::.|.|...:.::|.:.:||.||
Human    76 IRIPKYGFNEGHSFRRQYKPLSLNRLQYLIDLGRVDPSQPIDLTQLVNGRGVTIQPLKRDYGVQL 140

  Fly   140 TDDGLDNFQAKINIEVQHASEAVIAAIEKNGGVIRTAYYDPRSLHMLANPKKWFEKGVPIPSRML 204
            .::|.|.|.||:|||||.|||..||||||||||:.||:||||||.::..|..:|.:|.|||.|||
Human   141 VEEGADTFTAKVNIEVQLASELAIAAIEKNGGVVTTAFYDPRSLDIVCKPVPFFLRGQPIPKRML 205

  Fly   205 PPQDAVDYYTDPKNRGYLANPEAISQDRLVLAQKYGYQLPKIEEDSAYEMLTTAKDPRQVFYGLE 269
            ||::.|.||||.|||||||:|....:.||.||:||||.||.|.:|..::||.|.|||||:|:||.
Human   206 PPEELVPYYTDAKNRGYLADPAKFPEARLELARKYGYILPDITKDELFKMLCTRKDPRQIFFGLA 270

  Fly   270 PGWLINIVDKTIIK 283
            |||::|:.||.|:|
Human   271 PGWVVNMADKKILK 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL15NP_524185.1 Ribosomal_L18e 45..175 CDD:279201 68/129 (53%)
MRPL15NP_054894.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 22..66 19/43 (44%)
Ribosomal_L27A 53..176 CDD:395666 64/122 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160160
Domainoid 1 1.000 142 1.000 Domainoid score I4694
eggNOG 1 0.900 - - E1_COG0200
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H32210
Inparanoid 1 1.050 309 1.000 Inparanoid score I2613
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55287
OrthoDB 1 1.010 - - D423799at33208
OrthoFinder 1 1.000 - - FOG0003453
OrthoInspector 1 1.000 - - oto89664
orthoMCL 1 0.900 - - OOG6_100988
Panther 1 1.100 - - LDO PTHR12934
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5091
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.770

Return to query results.
Submit another query.