DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL15 and mrpl15

DIOPT Version :9

Sequence 1:NP_524185.1 Gene:mRpL15 / 40261 FlyBaseID:FBgn0036990 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_001120107.1 Gene:mrpl15 / 100145126 XenbaseID:XB-GENE-976976 Length:296 Species:Xenopus tropicalis


Alignment Length:284 Identity:154/284 - (54%)
Similarity:199/284 - (70%) Gaps:1/284 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAHLRETSDKALKLLRTLPRVQIGNLRPNPNSKQNDK-RGRAQHGGDKHGAGNKGSGQRQNFMRL 64
            ||....:.:||.:|||.||||.:.||||||.::..:| |||..|||.|.|.|:||..||.|..||
 Frog     1 MAASGGSGEKATELLRCLPRVTLANLRPNPGARHKEKRRGRGIHGGRKSGRGHKGETQRGNQPRL 65

  Fly    65 GYETGNQPFYLRFPYEPYYKGHHLKRQYPPISLLQLQVLIDTNRIDISQPIDISTLCNSGLLKLK 129
            |:|.|..||||..|...|.:||..:|||.|:||.:||.|||..|||.:||||::.|.|:..:.::
 Frog    66 GFEGGQTPFYLVIPKYGYNEGHSFRRQYQPLSLRRLQYLIDLGRIDPAQPIDLTQLVNARGVTIQ 130

  Fly   130 PAEMEYGFQLTDDGLDNFQAKINIEVQHASEAVIAAIEKNGGVIRTAYYDPRSLHMLANPKKWFE 194
            |.:.:||.||.::|.|.|.||||||||.||:..|||:|||||||.|.:||||||.:|..|..:|.
 Frog   131 PLKRDYGVQLVEEGSDIFSAKINIEVQWASQLAIAAVEKNGGVITTGFYDPRSLEVLCKPVPFFM 195

  Fly   195 KGVPIPSRMLPPQDAVDYYTDPKNRGYLANPEAISQDRLVLAQKYGYQLPKIEEDSAYEMLTTAK 259
            :|.|||.|||||:|.|.||||.:.|||||:|..:.:.|..||:||||.||.|.:|..|:||.|.|
 Frog   196 RGQPIPKRMLPPEDLVKYYTDGETRGYLADPRKVLEARKQLAKKYGYILPDITKDELYQMLCTRK 260

  Fly   260 DPRQVFYGLEPGWLINIVDKTIIK 283
            ||||:|:||.|||::|:.:|.|:|
 Frog   261 DPRQIFFGLAPGWVVNMSEKKILK 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL15NP_524185.1 Ribosomal_L18e 45..175 CDD:279201 70/129 (54%)
mrpl15NP_001120107.1 Ribosomal_L27A 48..175 CDD:376394 68/126 (54%)
PLN02503 <181..>231 CDD:215279 28/49 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 138 1.000 Domainoid score I4828
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H32210
Inparanoid 1 1.050 282 1.000 Inparanoid score I2822
OMA 1 1.010 - - QHG55287
OrthoDB 1 1.010 - - D423799at33208
OrthoFinder 1 1.000 - - FOG0003453
OrthoInspector 1 1.000 - - oto103482
Panther 1 1.100 - - LDO PTHR12934
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1154
SonicParanoid 1 1.000 - - X5091
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.