DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Las and AT5G08415

DIOPT Version :9

Sequence 1:NP_524183.2 Gene:Las / 40259 FlyBaseID:FBgn0029158 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_568196.1 Gene:AT5G08415 / 830740 AraportID:AT5G08415 Length:394 Species:Arabidopsis thaliana


Alignment Length:316 Identity:183/316 - (57%)
Similarity:229/316 - (72%) Gaps:4/316 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 EQYDG---KLRREKGEEQRLRLPPWLKTTIPVGKNYAKIKAQMRELKLSTVCEEARCPNIGECWG 116
            |.|.|   |:....|.:..::.|.||:...|.|:.:.::|..:..|.|:||||||:||||||||.
plant    76 EPYPGGMPKMGPFTGRDPNVKKPAWLRQKAPQGERFQEVKESLSRLNLNTVCEEAQCPNIGECWN 140

  Fly   117 GGEHGTQTATIMLMGDTCTRGCRFCSVKTARKPPPLDVNEPVNTATAIASWGLDYIVLTSVDRDD 181
            ||..|..|||||::|||||||||||:|||:|.|||.|..||.|||.||||||:||||:|||||||
plant   141 GGGDGVATATIMVLGDTCTRGCRFCAVKTSRNPPPPDPMEPENTAKAIASWGVDYIVITSVDRDD 205

  Fly   182 LPDGGSEHIAETVREIKARNSNIFVECLVPDFRGNLECVKTIANSGLDVYAHNIETVEKLTPYVR 246
            :|||||.|.|:||:.:|....:|.:|||..||||:||.|.|:.:|||||:|||:|||::|...||
plant   206 IPDGGSGHFAQTVKAMKRHKPDIMIECLTSDFRGDLEAVDTLVHSGLDVFAHNVETVKRLQRLVR 270

  Fly   247 DRRAHYRQTLQVLTEAKRFNPNLITKSSIMLGLGETDEEIENTLKDLREAGVDCVTLGQYMQPTN 311
            |.||.|.|::.||..||...|.:|||:||||||||||||::..:.|||...||.:|||||:|||.
plant   271 DPRAGYEQSMSVLKHAKISKPGMITKTSIMLGLGETDEELKEAMADLRAIDVDILTLGQYLQPTP 335

  Fly   312 KHLKVIEYVTPEKFKHWEERGNELGFLYTASGPLVRSSYKAGEFFI-TSILENRKK 366
            .||.|.||||||||..|:..|..:||.|.||||||||||:|||.|: |.:.|:..|
plant   336 LHLTVKEYVTPEKFDFWKTYGESIGFRYVASGPLVRSSYRAGELFVKTMVKESYSK 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LasNP_524183.2 LIAS_N 3..108 CDD:293486 19/55 (35%)
PLN02428 19..368 CDD:215236 183/316 (58%)
Radical_SAM 131..307 CDD:100105 111/175 (63%)
AT5G08415NP_568196.1 PLN02428 51..392 CDD:215236 183/316 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 218 1.000 Domainoid score I737
eggNOG 1 0.900 - - E1_COG0320
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H4997
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG60997
OrthoDB 1 1.010 - - D610833at2759
OrthoFinder 1 1.000 - - FOG0003202
OrthoInspector 1 1.000 - - oto4016
orthoMCL 1 0.900 - - OOG6_100980
Panther 1 1.100 - - O PTHR10949
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2153
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.790

Return to query results.
Submit another query.