DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Las and ART3

DIOPT Version :10

Sequence 1:NP_524183.2 Gene:Las / 40259 FlyBaseID:FBgn0029158 Length:377 Species:Drosophila melanogaster
Sequence 2:XP_016863695.1 Gene:ART3 / 419 HGNCID:725 Length:457 Species:Homo sapiens


Alignment Length:100 Identity:22/100 - (22%)
Similarity:41/100 - (41%) Gaps:24/100 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 FVQNP--------DNTRNEWEQYDGKLRREKGEEQRLRL--P---PWLKTTIPVGKNYAKIKAQM 94
            :|.||        |::...|:..|...:.:|.|:..:::  |   |.:|...|......|: .|:
Human   278 YVYNPGEKNQKLEDHSEKNWKLEDHGEKNQKLEDHGVKILEPTQIPGMKIPEPFPLPGIKM-IQL 341

  Fly    95 RELKLSTVCEEARCPNIGECWGGGEHGTQTATIML 129
            .|          :..||....|||...:::.||::
Human   342 NE----------KPGNIFFIGGGGTMDSKSFTIII 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LasNP_524183.2 PLN02428 19..368 CDD:215236 22/99 (22%)
ART3XP_016863695.1 ART 29..252 CDD:279473
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.