DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Las and LIAS

DIOPT Version :9

Sequence 1:NP_524183.2 Gene:Las / 40259 FlyBaseID:FBgn0029158 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_006850.2 Gene:LIAS / 11019 HGNCID:16429 Length:372 Species:Homo sapiens


Alignment Length:350 Identity:231/350 - (66%)
Similarity:280/350 - (80%) Gaps:5/350 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 RAASTNAEKLEEIRERLAKGPNFHDFVQNPDNTRNEWEQYDGKLRREKGEEQRLRLPPWLKTTIP 82
            |..|:..:|.:|:   |..||:..|||......|:.|::|.|.|:|:|||  ||||||||||.||
Human    26 RPLSSLPDKKKEL---LQNGPDLQDFVSGDLADRSTWDEYKGNLKRQKGE--RLRLPPWLKTEIP 85

  Fly    83 VGKNYAKIKAQMRELKLSTVCEEARCPNIGECWGGGEHGTQTATIMLMGDTCTRGCRFCSVKTAR 147
            :||||.|:|..:|.|.|.|||||||||||||||||||:.|.||||||||||||||||||||||||
Human    86 MGKNYNKLKNTLRNLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCTRGCRFCSVKTAR 150

  Fly   148 KPPPLDVNEPVNTATAIASWGLDYIVLTSVDRDDLPDGGSEHIAETVREIKARNSNIFVECLVPD 212
            .|||||.:||.|||.|||.|||||:|||||||||:||||:||||:||..:|.||..|.||||.||
Human   151 NPPPLDASEPYNTAKAIAEWGLDYVVLTSVDRDDMPDGGAEHIAKTVSYLKERNPKILVECLTPD 215

  Fly   213 FRGNLECVKTIANSGLDVYAHNIETVEKLTPYVRDRRAHYRQTLQVLTEAKRFNPNLITKSSIML 277
            |||:|:.::.:|.|||||||||:|||.:|...|||.||::.|:|:||..||:..|::|:|:||||
Human   216 FRGDLKAIEKVALSGLDVYAHNVETVPELQSKVRDPRANFDQSLRVLKHAKKVQPDVISKTSIML 280

  Fly   278 GLGETDEEIENTLKDLREAGVDCVTLGQYMQPTNKHLKVIEYVTPEKFKHWEERGNELGFLYTAS 342
            ||||.||::..|:|.||||.|||:|||||||||.:||||.||:||||||:||:.||||||.||||
Human   281 GLGENDEQVYATMKALREADVDCLTLGQYMQPTRRHLKVEEYITPEKFKYWEKVGNELGFHYTAS 345

  Fly   343 GPLVRSSYKAGEFFITSILENRKKR 367
            ||||||||||||||:.:::..||.:
Human   346 GPLVRSSYKAGEFFLKNLVAKRKTK 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LasNP_524183.2 LIAS_N 3..108 CDD:293486 46/89 (52%)
PLN02428 19..368 CDD:215236 230/348 (66%)
Radical_SAM 131..307 CDD:100105 119/175 (68%)
LIASNP_006850.2 PLN02428 22..370 CDD:215236 231/348 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147844
Domainoid 1 1.000 229 1.000 Domainoid score I2486
eggNOG 1 0.900 - - E1_COG0320
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4997
Inparanoid 1 1.050 482 1.000 Inparanoid score I1467
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG60997
OrthoDB 1 1.010 - - D464271at33208
OrthoFinder 1 1.000 - - FOG0003202
OrthoInspector 1 1.000 - - oto89917
orthoMCL 1 0.900 - - OOG6_100980
Panther 1 1.100 - - LDO PTHR10949
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R658
SonicParanoid 1 1.000 - - X2153
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.