DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5274 and Y56A3A.31

DIOPT Version :9

Sequence 1:NP_649222.1 Gene:CG5274 / 40257 FlyBaseID:FBgn0036987 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_001368604.1 Gene:Y56A3A.31 / 190330 WormBaseID:WBGene00013243 Length:424 Species:Caenorhabditis elegans


Alignment Length:165 Identity:41/165 - (24%)
Similarity:72/165 - (43%) Gaps:18/165 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 DGDVRKSQALPISQMNLFQEFQLIIALIEYFSRPGRDATRNAIFLSLF-----GSHLTPQRSKLL 121
            |.|:...|:...::||..|:.||:..|.::|.....|..|.:.|.::|     ...|...|..::
 Worm   104 DKDLFLIQSDRRTKMNAMQQLQLVRVLAQFFLERVDDGHRYSYFEAIFLGRSDDPTLHEYRLSVM 168

  Fly   122 SRLISTAVSGSVAPLLSSAGTW---MQQVGCKTPLSLEVAQNIVSDFISYSRKTPEQLKQL-PMV 182
            .:|:|.::...|..:|:....|   |:.|..:...|..:...|:..|:..|.:.....:.| |:.
 Worm   169 FQLVSFSIQYPVLQILNHVMGWLCQMKNVEQERIYSDRLIDMIIEHFVRLSNEQNRMHEYLIPLE 233

  Fly   183 G--PHFAANFMVAVADLYLNEQRSPTLNPPPDALL 215
            |  ..|.|.| |:.|.|:     .| |:||...|:
 Worm   234 GTCSEFCALF-VSRATLH-----GP-LSPPMITLI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5274NP_649222.1 DUF4507 14..360 CDD:291625 41/165 (25%)
Y56A3A.31NP_001368604.1 DUF4507 114..>244 CDD:405629 30/130 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167545
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR14540
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.