DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5282 and Dpep3

DIOPT Version :9

Sequence 1:NP_649221.1 Gene:CG5282 / 40256 FlyBaseID:FBgn0036986 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_082236.1 Gene:Dpep3 / 71854 MGIID:1919104 Length:493 Species:Mus musculus


Alignment Length:354 Identity:109/354 - (30%)
Similarity:190/354 - (53%) Gaps:57/354 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 LLEARLAFIRRLLTESPLIEGSWKPP----------------STMSLNSSNLFEVRQNHIGAVLW 160
            |.|..||.:|    :.||::|....|                ...:...:||..:|...:||..|
Mouse    77 LREQALALMR----DFPLVDGHNDLPLLLRELFQNQLQDVNLRNFTRGQTNLDRLRDGLVGAQFW 137

  Fly   161 PIAVPCGAQYLDAVQLTLEGIDRAKRITAATDSMHIVESADEMEQTHIRGEVAVLMGISGGHALG 225
            ...:||..|..|||:|.||.||..:|:.:|...:.:|.|||.:..|.   ::|.|:|:.|||:|.
Mouse   138 SAYIPCQTQDRDAVRLALEQIDLIRRMCSAYPELELVTSADGLNNTQ---KLACLIGVEGGHSLD 199

  Fly   226 TSTAVLRSIYLLGARFVSITSLECTTPWAAAAIRRPDYLVEENVTNSFNEFGQTMLFEMNRLGML 290
            ||.|||||.|.||.|::::| ..|:||||.:|.:...:.. .|: :....||:.::.|||||||:
Mouse   200 TSLAVLRSFYELGVRYLTLT-FTCSTPWAESATKFRHHFY-TNI-SGLTSFGEKVVEEMNRLGMM 261

  Fly   291 VEISMLSEAAMLAVLKTAKAPVLLTNATPLSMCNSSNIASIPDHVLSLLPENGGVILLNLERCGD 355
            :::|..|:..:...|:.::|||:.:::...|:|:  |:.:|||.:|.||.:|||::::.|     
Mouse   262 IDLSHASDTLVKQTLEVSQAPVIFSHSAARSVCD--NLLNIPDDILQLLKKNGGIVMVTL----- 319

  Fly   356 RTLGVREAITAIN---------YVRKVAGVDHIGLGGA-------PK------SYALLLAELARD 398
             ::||.:.....|         ::|.|.|.:.||:||:       |:      :|.:|:.||. .
Mouse   320 -SMGVLQCSLFANVSTVADHFDHIRTVIGSEFIGIGGSYDGSGRFPQGLEDVSTYPVLIEELL-S 382

  Fly   399 RVWGNAAIKKLVGGNVMRILREIETLKNR 427
            |.|....::.::.||::|:.|::|.::.:
Mouse   383 RGWDERELQGVLRGNLLRVFRQVEQVREK 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5282NP_649221.1 Peptidase_M19 123..420 CDD:395996 102/334 (31%)
Dpep3NP_082236.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 41..74
Peptidase_M19 83..404 CDD:279569 104/339 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2355
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1272387at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10443
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.880

Return to query results.
Submit another query.