DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5282 and DPEP3

DIOPT Version :9

Sequence 1:NP_649221.1 Gene:CG5282 / 40256 FlyBaseID:FBgn0036986 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_001357127.1 Gene:DPEP3 / 64180 HGNCID:23029 Length:488 Species:Homo sapiens


Alignment Length:388 Identity:106/388 - (27%)
Similarity:204/388 - (52%) Gaps:67/388 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 GIPLALQLRSSSLLEARLAFIRRLLTESPLIEGSWKPPSTM----------------SLNSSNLF 148
            |.|..|.||..:         :.|:...||::|....|..:                |...::|.
Human    73 GTPKTLDLRGRA---------QALMRSFPLVDGHNDLPQVLRQRYKNVLQDVNLRNFSHGQTSLD 128

  Fly   149 EVRQNHIGAVLWPIAVPCGAQYLDAVQLTLEGIDRAKRITAATDSMHIVESADEMEQTHIRGEVA 213
            .:|...:||..|..:|.|.:|...||:|.||.||...|:.|:...:.:|.||:.:..:.   ::|
Human   129 RLRDGLVGAQFWSASVSCQSQDQTAVRLALEQIDLIHRMCASYSELELVTSAEGLNSSQ---KLA 190

  Fly   214 VLMGISGGHALGTSTAVLRSIYLLGARFVSITSLECTTPWAAAAIRRPDYLVEENVTNSFNEFGQ 278
            .|:|:.|||:|.:|.:||||.|:||.|::::| ..|:||||.::.:...::. .|| :....||:
Human   191 CLIGVEGGHSLDSSLSVLRSFYVLGVRYLTLT-FTCSTPWAESSTKFRHHMY-TNV-SGLTSFGE 252

  Fly   279 TMLFEMNRLGMLVEISMLSEAAMLAVLKTAKAPVLLTNATPLSMCNSSNIASIPDHVLSLLPENG 343
            .::.|:|||||::::|..|:..:..||:.::|||:.:::...::|:  |:.::||.:|.||.:||
Human   253 KVVEELNRLGMMIDLSYASDTLIRRVLEVSQAPVIFSHSAARAVCD--NLLNVPDDILQLLKKNG 315

  Fly   344 GVILLNLERCGDRTLGVREAITAIN---------YVRKVAGVDHIGLGG-------APK------ 386
            |::::.|      ::||.:.....|         ::|.|.|.:.||:||       .|:      
Human   316 GIVMVTL------SMGVLQCNLLANVSTVADHFDHIRAVIGSEFIGIGGNYDGTGRFPQGLEDVS 374

  Fly   387 SYALLLAELARDRVWGNAAIKKLVGGNVMRILREIETLKN----RLPLYEEWIPHESIESNSY 445
            :|.:|:.||. .|.|....::.::.||::|:.|::|.::.    :.|:..|: |:..:.::.:
Human   375 TYPVLIEELL-SRSWSEEELQGVLRGNLLRVFRQVEKVREESRAQSPVEAEF-PYGQLSTSCH 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5282NP_649221.1 Peptidase_M19 123..420 CDD:395996 96/334 (29%)
DPEP3NP_001357127.1 Peptidase_M19 87..407 CDD:395996 96/334 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2355
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1272387at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10443
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
54.880

Return to query results.
Submit another query.