DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5282 and DPEP2

DIOPT Version :9

Sequence 1:NP_649221.1 Gene:CG5282 / 40256 FlyBaseID:FBgn0036986 Length:451 Species:Drosophila melanogaster
Sequence 2:XP_011521568.1 Gene:DPEP2 / 64174 HGNCID:23028 Length:499 Species:Homo sapiens


Alignment Length:380 Identity:110/380 - (28%)
Similarity:195/380 - (51%) Gaps:71/380 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 RRLLTESPLIEGSWKPPSTM----------------SLNSSNLFEVRQNHIGAVLWPIAVPCGAQ 169
            |.|:.:.||::|....|..:                |...::|..:|...:||..|...|||..|
Human    77 RALMRDFPLVDGHNDLPLVLRQVYQKGLQDVNLRNFSYGQTSLDRLRDGLVGAQFWSAYVPCQTQ 141

  Fly   170 YLDAVQLTLEGIDRAKRITAATDSMHIVESADEMEQTHIRGEVAVLMGISGGHALGTSTAVLRSI 234
            ..||::||||.||..:|:.|:...:.:|.||..:..|.   ::|.|:|:.|||:|..|.::||:.
Human   142 DRDALRLTLEQIDLIRRMCASYSELELVTSAKALNDTQ---KLACLIGVEGGHSLDNSLSILRTF 203

  Fly   235 YLLGARFVSITSLECTTPWAAAAIRRPDYLVEENVTNSFNEFGQTMLFEMNRLGMLVEISMLSEA 299
            |:||.|::::|. .|.||||.::.:......  |..:...:||:.::.|||||||:|::|.:|:|
Human   204 YMLGVRYLTLTH-TCNTPWAESSAKGVHSFY--NNISGLTDFGEKVVAEMNRLGMMVDLSHVSDA 265

  Fly   300 AMLAVLKTAKAPVLLTNATPLSMCNSSNIASIPDHVLSLLPENGGVILLNLERCGDRTLGVREAI 364
            .....|:.::|||:.:::....:|||:.  ::||.:|.||.:||||::::|      ::||.:..
Human   266 VARRALEVSQAPVIFSHSAARGVCNSAR--NVPDDILQLLKKNGGVVMVSL------SMGVIQCN 322

  Fly   365 TAIN---------YVRKVAGVDHIGLGG-----------APKS---------------YALLLAE 394
            .:.|         :::.|.|...||:||           .|.|               |.:|:.|
Human   323 PSANVSTVADHFDHIKAVIGSKFIGIGGDYDGAGKESGLKPTSWWPHRFPQGLEDVSTYPVLIEE 387

  Fly   395 LARDRVWGNAAIKKLVGGNVMRILREIETL----KNRLPLYEEWIPHESIESNSY 445
            |. .|.|....::.::.||::|:.|::|.:    |.:.|| |:..|.|.:.|:.:
Human   388 LL-SRGWSEEELQGVLRGNLLRVFRQVEKVQEENKWQSPL-EDKFPDEQLSSSCH 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5282NP_649221.1 Peptidase_M19 123..420 CDD:395996 100/347 (29%)
DPEP2XP_011521568.1 Peptidase_M19 78..412 CDD:279569 100/348 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2355
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1272387at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10443
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.880

Return to query results.
Submit another query.