DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5282 and Dpep3

DIOPT Version :9

Sequence 1:NP_649221.1 Gene:CG5282 / 40256 FlyBaseID:FBgn0036986 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_001008384.1 Gene:Dpep3 / 364994 RGDID:1305484 Length:488 Species:Rattus norvegicus


Alignment Length:354 Identity:108/354 - (30%)
Similarity:192/354 - (54%) Gaps:57/354 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 LLEARLAFIRRLLTESPLIEGSWKPP----------------STMSLNSSNLFEVRQNHIGAVLW 160
            |.|..||.:|    :.||::|....|                ...:...::|..:|...:||..|
  Rat    77 LREQALALMR----DFPLVDGHNDLPLLLRELFQNKLQDVNLHNFTRGQTSLDRLRDGLVGAQFW 137

  Fly   161 PIAVPCGAQYLDAVQLTLEGIDRAKRITAATDSMHIVESADEMEQTHIRGEVAVLMGISGGHALG 225
            ...:||..|..|||::.||.||..:|:.:|...:.:|.|||.:..|.   ::|.|:|:.|||:|.
  Rat   138 SAYIPCQTQDRDAVRVALEQIDLIRRMCSAYPELELVTSADGLNSTQ---KLACLIGLEGGHSLD 199

  Fly   226 TSTAVLRSIYLLGARFVSITSLECTTPWAAAAIRRPDYLVEENVTNSFNEFGQTMLFEMNRLGML 290
            ||.|||||.|.||.|::::| ..|:||||.:|.:...:.. .|: :....||:.::.||||:||:
  Rat   200 TSLAVLRSFYELGVRYLTLT-FTCSTPWAESATKFRHHFY-TNI-SGLTSFGEKVVEEMNRIGMM 261

  Fly   291 VEISMLSEAAMLAVLKTAKAPVLLTNATPLSMCNSSNIASIPDHVLSLLPENGGVILLNLERCGD 355
            :::|..|:..:...|:.::|||:.:::...|:|:  |:.::||.:|.||.:|||::::.|     
  Rat   262 IDLSHASDTLVKQTLEASRAPVIFSHSAARSVCD--NLLNVPDDILQLLKKNGGIVMVTL----- 319

  Fly   356 RTLGVREAITAIN---------YVRKVAGVDHIGLGGA-------PK------SYALLLAELARD 398
             ::||.:.....|         ::|.|.|.:.||:||:       |:      :|.:||.||.| 
  Rat   320 -SMGVLQCSLLANVSTVADHFDHIRTVIGSEFIGIGGSYDGSGRFPQGLEDVSTYPVLLEELLR- 382

  Fly   399 RVWGNAAIKKLVGGNVMRILREIETLKNR 427
            |.||...::.::.||::|:.|::|.::.:
  Rat   383 RGWGEQELQGVLRGNLLRVFRQVEQVREK 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5282NP_649221.1 Peptidase_M19 123..420 CDD:395996 101/334 (30%)
Dpep3NP_001008384.1 Podoplanin 26..>76 CDD:283467
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 41..74
Peptidase_M19 83..404 CDD:279569 103/339 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2355
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1272387at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10443
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.880

Return to query results.
Submit another query.