DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5282 and Dpep2

DIOPT Version :9

Sequence 1:NP_649221.1 Gene:CG5282 / 40256 FlyBaseID:FBgn0036986 Length:451 Species:Drosophila melanogaster
Sequence 2:XP_008770709.1 Gene:Dpep2 / 291984 RGDID:1305746 Length:566 Species:Rattus norvegicus


Alignment Length:382 Identity:115/382 - (30%)
Similarity:195/382 - (51%) Gaps:72/382 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 RRLLTESPLIEGSWKPPSTM------SLNSSN----------LFEVRQNHIGAVLWPIAVPCGAQ 169
            |.|:.:.|||:|....|..:      .|..:|          |..::...:||..|...|||..|
  Rat   163 RALMQDFPLIDGHNDLPLVLRQFYQNGLQDTNLRNFTHGQTSLNRLKDGFVGAQFWSAYVPCQTQ 227

  Fly   170 YLDAVQLTLEGIDRAKRITAATDSMHIVESADEMEQTHIRGEVAVLMGISGGHALGTSTAVLRSI 234
            ..||::||||.||..:|:.|:...:.:|.|...:..|.   ::|.|:|:.|||:|..|.|||||.
  Rat   228 DRDALRLTLEQIDLIRRMCASYSELELVTSVQALNSTQ---KLACLIGVEGGHSLDNSLAVLRSF 289

  Fly   235 YLLGARFVSITSLECTTPWAAAAIRRPDYLVEENVTNSFNEFGQTMLFEMNRLGMLVEISMLSEA 299
            ||||.|::::|. .|.||||.::.:  |.....:.......||:.::.|||||||::::|.:|:|
  Rat   290 YLLGVRYLTLTH-TCNTPWAESSSK--DVHSFYSSVKGLTSFGEKVVAEMNRLGMMIDLSHVSDA 351

  Fly   300 AMLAVLKTAKAPVLLTNATPLSMCNSSNIASIPDHVLSLLPENGGVI-------------LLNLE 351
            .....|:.::|||:.:::...::|  .|..::||.:|.||.:|||::             |.|:.
  Rat   352 TARQALEVSQAPVIFSHSAARAVC--PNARNLPDDILQLLKKNGGIVMVTFAVGVLPCNPLANVS 414

  Fly   352 RCGDRTLGVREAITAINYVRKVAGVDHIGLGG-------APK------SYALLLAELARDRVWGN 403
            ...|.          .:::|.|.|.:.||:||       .|:      :|.:|:.||.| |.||.
  Rat   415 TVADH----------FDHIRTVIGSEFIGVGGDYDGTKQFPQGLEDVSTYPVLIEELLR-RGWGE 468

  Fly   404 AAIKKLVGGNVMRILREIETLKNR----LPLYEEWIPHESIESNSYC------RYPE 450
            ..::.::.||::|:.|::|.::.:    .|| |:.||.|.::|..:.      :|||
  Rat   469 QELQGVLRGNLLRVFRQVEQVREKNKWQSPL-EDMIPEEQLDSACHSVLPHRRQYPE 524

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5282NP_649221.1 Peptidase_M19 123..420 CDD:395996 102/338 (30%)
Dpep2XP_008770709.1 Peptidase_M19 164..485 CDD:279569 102/339 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2355
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1272387at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10443
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.880

Return to query results.
Submit another query.