DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5282 and SPCC965.12

DIOPT Version :9

Sequence 1:NP_649221.1 Gene:CG5282 / 40256 FlyBaseID:FBgn0036986 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_001342728.1 Gene:SPCC965.12 / 2539107 PomBaseID:SPCC965.12 Length:416 Species:Schizosaccharomyces pombe


Alignment Length:345 Identity:98/345 - (28%)
Similarity:167/345 - (48%) Gaps:51/345 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 SNLFEVRQNHIGAVLWPIAVPC-GAQYL--------DAVQLTLEGIDRAKRITAA-TDSMHIVES 199
            ::|.::||..:|...:...:.| ...||        ..|:.|||.||..:|:... .:.:..|:.
pombe    59 TDLVKMRQGQVGVQFFSCFIECKNPNYLYQDFDTPTTVVRDTLEQIDVTRRLVCKYNNDLKFVDC 123

  Fly   200 ADE-MEQTHIRGEVAVLMGISGGHALGTSTAVLRSIYLLGARFVSITSLECTTPWAAAAIR---- 259
            ||: :......|::|:.:|:.|.|.:.||.||||..|.||.|::::|. .|..|:|.||..    
pombe   124 ADDAIAAFRNNGKIAIALGVEGLHQVDTSLAVLRQYYSLGVRYITLTH-NCDNPFATAASSITGG 187

  Fly   260 RPDYLVEENVTNSFNEFGQTMLFEMNRLGMLVEISMLSEAAMLAVLKTAKAPVLLTNATPLSMCN 324
            .||        ...:.:|...:||||||||:|::|.:|...|...|...||||:.::::..::  
pombe   188 LPD--------RGLSAYGIECIFEMNRLGMMVDLSHVSHRTMHDALDVTKAPVIFSHSSAYTL-- 242

  Fly   325 SSNIASIPDHVLSLLPENGGVILLN-----LERCGDRTLGVREAITAINYVRKVAGVDHIGLG-- 382
            :.:..::.|.||..|..||||:.:|     :.:.|.....:.:|...|.::.||||.:|:|||  
pombe   243 TEHERNVRDDVLERLKTNGGVVQVNFYQDFIRKPGSDRATIDDAADHILHIIKVAGWEHVGLGSD 307

  Fly   383 --GAPK---------SYALLLAELARDRVWGNAAIKKLVGGNVMRILREIETLKNRL-----PLY 431
              |.|:         .|..|:.::.......|..|:.|:|.||:|:.::.|.:..:|     |:.
pombe   308 FDGIPQGPKGLEDVSKYPDLICKIIERTNATNEQIEGLMGLNVLRVWKKTELVALQLSKKLEPIE 372

  Fly   432 EEWIPHESIESNSYCR-YPE 450
            ..| .....|..||.: :||
pombe   373 SSW-SGRKWEFYSYAKEFPE 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5282NP_649221.1 Peptidase_M19 123..420 CDD:395996 89/307 (29%)
SPCC965.12NP_001342728.1 Peptidase_M19 18..356 CDD:279569 89/307 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2355
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10443
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.