DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5282 and DPEP1

DIOPT Version :9

Sequence 1:NP_649221.1 Gene:CG5282 / 40256 FlyBaseID:FBgn0036986 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_001121613.1 Gene:DPEP1 / 1800 HGNCID:3002 Length:411 Species:Homo sapiens


Alignment Length:368 Identity:105/368 - (28%)
Similarity:192/368 - (52%) Gaps:56/368 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 RLLTESPLIEGSWKPP------------------STMSLNSSNLFEVRQNHIGAVLWPIAVPCGA 168
            |::.:||:|:|....|                  :|::...:|:.::|...:|...|.:..||..
Human    25 RIMRDSPVIDGHNDLPWQLLDMFNNRLQDERANLTTLAGTHTNIPKLRAGFVGGQFWSVYTPCDT 89

  Fly   169 QYLDAVQLTLEGIDRAKRITAA-TDSMHIVESADEMEQTHIRGEVAVLMGISGGHALGTSTAVLR 232
            |..|||:.|||.:|...|:... .::...|.|:..:.|....|:||.|:|:.|||::.:|..|||
Human    90 QNKDAVRRTLEQMDVVHRMCRMYPETFLYVTSSAGIRQAFREGKVASLIGVEGGHSIDSSLGVLR 154

  Fly   233 SIYLLGARFVSITSLECTTPWAAAAIRRPDYLVE----ENVTNSFNEFGQTMLFEMNRLGMLVEI 293
            ::|.||.|::::|. .|.||||      .::||:    |..:...:.|||.::.|:||||:|:::
Human   155 ALYQLGMRYLTLTH-SCNTPWA------DNWLVDTGDSEPQSQGLSPFGQRVVKELNRLGVLIDL 212

  Fly   294 SMLSEAAMLAVLKTAKAPVLLTNATPLSMCNSSNIASIPDHVLSLLPENGGVILLNLER----CG 354
            :.:|.|.|.|.|:.::|||:.::::..|:|.|..  ::||.||.|:.:...::::|...    |.
Human   213 AHVSVATMKATLQLSRAPVIFSHSSAYSVCASRR--NVPDDVLRLVKQTDSLVMVNFYNNYISCT 275

  Fly   355 DRTLGVREAITAINYVRKVAGVDHIGLG----GAPK---------SYALLLAELARDRVWGNAAI 406
            ::. .:.:....::::::|||...:|.|    |.|:         .|..|:|||.| |.|..|.:
Human   276 NKA-NLSQVADHLDHIKEVAGARAVGFGGDFDGVPRVPEGLEDVSKYPDLIAELLR-RNWTEAEV 338

  Fly   407 KKLVGGNVMRILREIETLKN--RLPLYEEWIPHESIESNSYCR 447
            |..:..|::|:...:|...|  :.| .||.||.:.:..:  ||
Human   339 KGALADNLLRVFEAVEQASNLTQAP-EEEPIPLDQLGGS--CR 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5282NP_649221.1 Peptidase_M19 123..420 CDD:395996 95/336 (28%)
DPEP1NP_001121613.1 Peptidase_M19 26..352 CDD:395996 95/336 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2355
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6062
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1272387at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10443
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.