DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zye and m

DIOPT Version :9

Sequence 1:NP_649220.1 Gene:zye / 40255 FlyBaseID:FBgn0036985 Length:2284 Species:Drosophila melanogaster
Sequence 2:NP_572747.1 Gene:m / 44835 FlyBaseID:FBgn0002577 Length:682 Species:Drosophila melanogaster


Alignment Length:274 Identity:85/274 - (31%)
Similarity:135/274 - (49%) Gaps:20/274 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 LGELEFDDSSPRLTRDTSLSAKHIEKIDVKCDQGSGMMVEVEFSEDFEGVIYSQGYFSDPKCNYV 96
            |..:|..|..|           :|..::|.|.: ..|.|.:.||..|||::.|:|..|||:|.||
  Fly    36 LWPMERPDGMP-----------NIVSLEVMCGK-DHMDVHLTFSHPFEGIVSSKGQHSDPRCVYV 88

  Fly    97 KGDRSGRSFTFTVPYDGCGSKPSCSVCASIENILIIQDDRDIQNSFDIARKISCSRGDEREKTVY 161
            ........|:|.:.|..||:||..: ....||.:::|.|:|:...:|.|:::.|...::.|||..
  Fly    89 PPSTGKTFFSFRISYSRCGTKPDLN-GQFYENTVVVQYDKDLLEVWDEAKRLRCEWFNDYEKTAS 152

  Fly   162 FKPFVVDMLEVISVDTPSGPVECWMEIGTGTPPNVKPIQGTLTLGTDITFTINVKHSEQAWDINI 226
            ..|.|:..|:||.:|.....|:|||||..|..|...|:.|.:.||:.:|..:.:......:|:.:
  Fly   153 KPPMVIADLDVIQLDFRGDNVDCWMEIQHGKGPWAPPVSGIVPLGSTLTLVVAINDYRGEFDMRV 217

  Fly   227 LQCYASDDMDFEARTTKRLQLSDKRGCSIKEKIFGEWRKFEA-GSSLTSTYYNTLKAFRFPDRSQ 290
            ..|.|||.      :...:.|||:.||.::.|:...:.|..| ....|...|....||:|||...
  Fly   218 KSCVASDG------SGHVINLSDEFGCVLRPKMISRFLKARAPDERATVITYAFFHAFKFPDALS 276

  Fly   291 VYLKCDIELCNGAC 304
            |::||.:|:|...|
  Fly   277 VHIKCKVEICRHGC 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zyeNP_649220.1 ZP 61..313 CDD:214579 79/245 (32%)
mNP_572747.1 ZP 55..286 CDD:214579 77/238 (32%)
Zona_pellucida <194..287 CDD:278526 27/98 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473288
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005923
OrthoInspector 1 1.000 - - otm14807
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR46560
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.