DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zye and CG17111

DIOPT Version :9

Sequence 1:NP_649220.1 Gene:zye / 40255 FlyBaseID:FBgn0036985 Length:2284 Species:Drosophila melanogaster
Sequence 2:NP_651119.2 Gene:CG17111 / 42727 FlyBaseID:FBgn0039048 Length:792 Species:Drosophila melanogaster


Alignment Length:377 Identity:70/377 - (18%)
Similarity:132/377 - (35%) Gaps:105/377 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 RDTSLSAKHIEKIDVK--CDQGSGMMVEVEFSEDFEGVIYSQGYFSDPKC--------------- 93
            |:.|:..:.::.:||:  |.:.. |.::....:.|.|.||:..:..|  |               
  Fly   336 RENSVYMRRVKCLDVRVFCTRDE-MTIKYNPKDWFVGKIYASMHSKD--CLARGSGNGSVLLTLQ 397

  Fly    94 --NYVKGDRSG--RSFTFTVPYDGCGSKPSCSVCASIENILIIQDDRDIQNSFDIARKISCSRGD 154
              :.||.:|.|  |::..|..|..          ..|..:::||::.::|...|...|:.|.:.:
  Fly   398 IGSEVKENRCGILRAYEMTQEYQR----------TFISALVVIQNNPNVQTQGDRLIKVGCIQSN 452

  Fly   155 EREKT-VYFKPFVVDMLEVISVDTPSG--------------PVECWMEIGTGTPPNVKPIQGTLT 204
            ..... |..:...||..|.:    ||.              |.|..:...:.|.|:..|     :
  Fly   453 ATTSLGVSVRDSSVDSSEPV----PSAIALESSLEYTEHMFPHEGVVHYNSSTGPHPHP-----S 508

  Fly   205 LGTDITFTINVKHSEQAWDINI-----LQCYA-------SDDMDFE-------------ARTTKR 244
            :...|   :::.|..:..|:.|     ||..|       ::.|:.:             |:|...
  Fly   509 ISLQI---LDLSHQHETNDVQIGQNLELQIVAEYSPQQLAEHMELQLAPLPDFRATSLVAKTADN 570

  Fly   245 ---LQLSDKRGCSIKEKIFGEWRKFEAGS-SLTSTYYNTLKAFRFPDRSQVYLKCDIELCNGACK 305
               :.|.|:|||.....:|....:....| |:....::   ||:|...:.|.....|..|...|.
  Fly   571 ENFVLLIDERGCPTDASVFPALERVHTASRSMLRARFH---AFKFSGTANVSFDVKIRFCVERCS 632

  Fly   306 RDYTCGS-----LRSLTCPEGSTDPQCLQDHL-------ISPKPRCYPGSNE 345
            ......|     .|....|:...:...:|:.:       ::|:|..:..|.|
  Fly   633 PSNCISSSWQRRRRQADQPDRRPEDLRVQNPVYISTVVDVAPQPDNFTRSQE 684

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zyeNP_649220.1 ZP 61..313 CDD:214579 59/321 (18%)
CG17111NP_651119.2 PAN_1 159..255 CDD:278453
PAN_AP_HGF 270..344 CDD:238532 2/7 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473286
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.