DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zye and CG10005

DIOPT Version :9

Sequence 1:NP_649220.1 Gene:zye / 40255 FlyBaseID:FBgn0036985 Length:2284 Species:Drosophila melanogaster
Sequence 2:NP_650137.3 Gene:CG10005 / 41451 FlyBaseID:FBgn0037972 Length:231 Species:Drosophila melanogaster


Alignment Length:157 Identity:39/157 - (24%)
Similarity:60/157 - (38%) Gaps:44/157 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 SAKHIEKIDVKCDQGSGMMVEVEFSEDFEGVIYSQGYFSDPKCNYVKGDRSGRSFTFTVPYDGCG 115
            |.:.|:|:::||...| |.|.:|..:.|.||:|::|.|                :..:.|   |.
  Fly    49 SDQGIQKVNLKCGADS-MNVVLETEKPFMGVMYTRGSF----------------YKQSAP---CF 93

  Fly   116 SKPSCS-------------VCASIE------NILIIQDDRDIQNSFDIARKISCSRGDEREKTVY 161
            .|||.|             .|.:|.      ||::||:|.::....|.|..:.|.....|...|.
  Fly    94 MKPSSSQGSRTMEMNFQLDQCQTIRDGDLYTNIVVIQNDPELITPGDSAFSLECDFRQPRNLDVE 158

  Fly   162 FKPFVVDMLEVISVDT-----PSGPVE 183
            ......|.:...|..|     |:.|.|
  Fly   159 ASMQARDRVATGSKITLTSPDPAAPTE 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zyeNP_649220.1 ZP 61..313 CDD:214579 36/147 (24%)
CG10005NP_650137.3 ZP 59..>162 CDD:214579 30/122 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473283
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR46560
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.